[chore]: Bump github.com/minio/minio-go/v7 from 7.0.72 to 7.0.73 (#3083)
This commit is contained in:
parent
ae349dd6a5
commit
43c480aec4
9
go.mod
9
go.mod
|
@ -43,7 +43,7 @@ require (
|
||||||
github.com/jackc/pgx/v5 v5.6.0
|
github.com/jackc/pgx/v5 v5.6.0
|
||||||
github.com/microcosm-cc/bluemonday v1.0.27
|
github.com/microcosm-cc/bluemonday v1.0.27
|
||||||
github.com/miekg/dns v1.1.61
|
github.com/miekg/dns v1.1.61
|
||||||
github.com/minio/minio-go/v7 v7.0.72
|
github.com/minio/minio-go/v7 v7.0.73
|
||||||
github.com/mitchellh/mapstructure v1.5.0
|
github.com/mitchellh/mapstructure v1.5.0
|
||||||
github.com/ncruces/go-sqlite3 v0.17.0
|
github.com/ncruces/go-sqlite3 v0.17.0
|
||||||
github.com/oklog/ulid v1.3.1
|
github.com/oklog/ulid v1.3.1
|
||||||
|
@ -119,6 +119,7 @@ require (
|
||||||
github.com/gin-contrib/sse v0.1.0 // indirect
|
github.com/gin-contrib/sse v0.1.0 // indirect
|
||||||
github.com/go-errors/errors v1.4.1 // indirect
|
github.com/go-errors/errors v1.4.1 // indirect
|
||||||
github.com/go-fed/httpsig v1.1.0 // indirect
|
github.com/go-fed/httpsig v1.1.0 // indirect
|
||||||
|
github.com/go-ini/ini v1.67.0 // indirect
|
||||||
github.com/go-jose/go-jose/v4 v4.0.1 // indirect
|
github.com/go-jose/go-jose/v4 v4.0.1 // indirect
|
||||||
github.com/go-logr/logr v1.4.1 // indirect
|
github.com/go-logr/logr v1.4.1 // indirect
|
||||||
github.com/go-logr/stdr v1.2.2 // indirect
|
github.com/go-logr/stdr v1.2.2 // indirect
|
||||||
|
@ -137,7 +138,7 @@ require (
|
||||||
github.com/go-playground/universal-translator v0.18.1 // indirect
|
github.com/go-playground/universal-translator v0.18.1 // indirect
|
||||||
github.com/go-playground/validator/v10 v10.20.0 // indirect
|
github.com/go-playground/validator/v10 v10.20.0 // indirect
|
||||||
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 // indirect
|
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 // indirect
|
||||||
github.com/goccy/go-json v0.10.2 // indirect
|
github.com/goccy/go-json v0.10.3 // indirect
|
||||||
github.com/godbus/dbus/v5 v5.0.4 // indirect
|
github.com/godbus/dbus/v5 v5.0.4 // indirect
|
||||||
github.com/golang-jwt/jwt v3.2.2+incompatible // indirect
|
github.com/golang-jwt/jwt v3.2.2+incompatible // indirect
|
||||||
github.com/golang/geo v0.0.0-20210211234256-740aa86cb551 // indirect
|
github.com/golang/geo v0.0.0-20210211234256-740aa86cb551 // indirect
|
||||||
|
@ -159,8 +160,8 @@ require (
|
||||||
github.com/jinzhu/inflection v1.0.0 // indirect
|
github.com/jinzhu/inflection v1.0.0 // indirect
|
||||||
github.com/josharian/intern v1.0.0 // indirect
|
github.com/josharian/intern v1.0.0 // indirect
|
||||||
github.com/json-iterator/go v1.1.12 // indirect
|
github.com/json-iterator/go v1.1.12 // indirect
|
||||||
github.com/klauspost/compress v1.17.8 // indirect
|
github.com/klauspost/compress v1.17.9 // indirect
|
||||||
github.com/klauspost/cpuid/v2 v2.2.7 // indirect
|
github.com/klauspost/cpuid/v2 v2.2.8 // indirect
|
||||||
github.com/kr/pretty v0.3.1 // indirect
|
github.com/kr/pretty v0.3.1 // indirect
|
||||||
github.com/kr/text v0.2.0 // indirect
|
github.com/kr/text v0.2.0 // indirect
|
||||||
github.com/leodido/go-urn v1.4.0 // indirect
|
github.com/leodido/go-urn v1.4.0 // indirect
|
||||||
|
|
18
go.sum
18
go.sum
|
@ -207,6 +207,8 @@ github.com/go-fed/httpsig v1.1.0/go.mod h1:RCMrTZvN1bJYtofsG4rd5NaO5obxQ5xBkdiS7
|
||||||
github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU=
|
github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU=
|
||||||
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
|
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
|
||||||
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
|
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
|
||||||
|
github.com/go-ini/ini v1.67.0 h1:z6ZrTEZqSWOTyH2FlglNbNgARyHG8oLW9gMELqKr06A=
|
||||||
|
github.com/go-ini/ini v1.67.0/go.mod h1:ByCAeIL28uOIIG0E3PJtZPDL8WnHpFKFOtgjp+3Ies8=
|
||||||
github.com/go-jose/go-jose/v4 v4.0.1 h1:QVEPDE3OluqXBQZDcnNvQrInro2h0e4eqNbnZSWqS6U=
|
github.com/go-jose/go-jose/v4 v4.0.1 h1:QVEPDE3OluqXBQZDcnNvQrInro2h0e4eqNbnZSWqS6U=
|
||||||
github.com/go-jose/go-jose/v4 v4.0.1/go.mod h1:WVf9LFMHh/QVrmqrOfqun0C45tMe3RoiKJMPvgWwLfY=
|
github.com/go-jose/go-jose/v4 v4.0.1/go.mod h1:WVf9LFMHh/QVrmqrOfqun0C45tMe3RoiKJMPvgWwLfY=
|
||||||
github.com/go-logr/logr v1.2.2/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A=
|
github.com/go-logr/logr v1.2.2/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A=
|
||||||
|
@ -254,8 +256,8 @@ github.com/go-test/deep v1.0.8 h1:TDsG77qcSprGbC6vTN8OuXp5g+J+b5Pcguhf7Zt61VM=
|
||||||
github.com/go-test/deep v1.0.8/go.mod h1:5C2ZWiW0ErCdrYzpqxLbTX7MG14M9iiw8DgHncVwcsE=
|
github.com/go-test/deep v1.0.8/go.mod h1:5C2ZWiW0ErCdrYzpqxLbTX7MG14M9iiw8DgHncVwcsE=
|
||||||
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 h1:PSPmmucxGiFBtbQcttHTUc4LQ3P09AW+ldO2qspyKdY=
|
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 h1:PSPmmucxGiFBtbQcttHTUc4LQ3P09AW+ldO2qspyKdY=
|
||||||
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850/go.mod h1:aUCEOzzezBEjDBbFBoSiya/gduyIiWYRP6CnSFIV8AM=
|
github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850/go.mod h1:aUCEOzzezBEjDBbFBoSiya/gduyIiWYRP6CnSFIV8AM=
|
||||||
github.com/goccy/go-json v0.10.2 h1:CrxCmQqYDkv1z7lO7Wbh2HN93uovUHgrECaO5ZrCXAU=
|
github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA=
|
||||||
github.com/goccy/go-json v0.10.2/go.mod h1:6MelG93GURQebXPDq3khkgXZkazVtN9CRI+MGFi0w8I=
|
github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M=
|
||||||
github.com/godbus/dbus/v5 v5.0.4 h1:9349emZab16e7zQvpmsbtjc18ykshndd8y2PG3sgJbA=
|
github.com/godbus/dbus/v5 v5.0.4 h1:9349emZab16e7zQvpmsbtjc18ykshndd8y2PG3sgJbA=
|
||||||
github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA=
|
github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA=
|
||||||
github.com/golang-jwt/jwt v3.2.1+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I=
|
github.com/golang-jwt/jwt v3.2.1+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I=
|
||||||
|
@ -391,12 +393,12 @@ github.com/k0kubun/colorstring v0.0.0-20150214042306-9440f1994b88/go.mod h1:3w7q
|
||||||
github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck=
|
github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck=
|
||||||
github.com/klauspost/compress v1.10.4/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
|
github.com/klauspost/compress v1.10.4/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
|
||||||
github.com/klauspost/compress v1.10.10/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
|
github.com/klauspost/compress v1.10.10/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
|
||||||
github.com/klauspost/compress v1.17.8 h1:YcnTYrq7MikUT7k0Yb5eceMmALQPYBW/Xltxn0NAMnU=
|
github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA=
|
||||||
github.com/klauspost/compress v1.17.8/go.mod h1:Di0epgTjJY877eYKx5yC51cX2A2Vl2ibi7bDH9ttBbw=
|
github.com/klauspost/compress v1.17.9/go.mod h1:Di0epgTjJY877eYKx5yC51cX2A2Vl2ibi7bDH9ttBbw=
|
||||||
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
||||||
github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
||||||
github.com/klauspost/cpuid/v2 v2.2.7 h1:ZWSB3igEs+d0qvnxR/ZBzXVmxkgt8DdzP6m9pfuVLDM=
|
github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM=
|
||||||
github.com/klauspost/cpuid/v2 v2.2.7/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
|
github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
|
||||||
github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M=
|
github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M=
|
||||||
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
|
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
|
||||||
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
|
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
|
||||||
|
@ -422,8 +424,8 @@ github.com/miekg/dns v1.1.61 h1:nLxbwF3XxhwVSm8g9Dghm9MHPaUZuqhPiGL+675ZmEs=
|
||||||
github.com/miekg/dns v1.1.61/go.mod h1:mnAarhS3nWaW+NVP2wTkYVIZyHNJ098SJZUki3eykwQ=
|
github.com/miekg/dns v1.1.61/go.mod h1:mnAarhS3nWaW+NVP2wTkYVIZyHNJ098SJZUki3eykwQ=
|
||||||
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
|
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
|
||||||
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
|
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
|
||||||
github.com/minio/minio-go/v7 v7.0.72 h1:ZSbxs2BfJensLyHdVOgHv+pfmvxYraaUy07ER04dWnA=
|
github.com/minio/minio-go/v7 v7.0.73 h1:qr2vi96Qm7kZ4v7LLebjte+MQh621fFWnv93p12htEo=
|
||||||
github.com/minio/minio-go/v7 v7.0.72/go.mod h1:4yBA8v80xGA30cfM3fz0DKYMXunWl/AV/6tWEs9ryzo=
|
github.com/minio/minio-go/v7 v7.0.73/go.mod h1:qydcVzV8Hqtj1VtEocfxbmVFa2siu6HGa+LDEPogjD8=
|
||||||
github.com/mitchellh/copystructure v1.0.0/go.mod h1:SNtv71yrdKgLRyLFxmLdkAbkKEFWgYaq1OVrnRcwhnw=
|
github.com/mitchellh/copystructure v1.0.0/go.mod h1:SNtv71yrdKgLRyLFxmLdkAbkKEFWgYaq1OVrnRcwhnw=
|
||||||
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
|
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
|
||||||
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
|
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
|
||||||
|
|
|
@ -0,0 +1,12 @@
|
||||||
|
# http://editorconfig.org
|
||||||
|
|
||||||
|
root = true
|
||||||
|
|
||||||
|
[*]
|
||||||
|
charset = utf-8
|
||||||
|
end_of_line = lf
|
||||||
|
insert_final_newline = true
|
||||||
|
trim_trailing_whitespace = true
|
||||||
|
|
||||||
|
[*_test.go]
|
||||||
|
trim_trailing_whitespace = false
|
|
@ -0,0 +1,7 @@
|
||||||
|
testdata/conf_out.ini
|
||||||
|
ini.sublime-project
|
||||||
|
ini.sublime-workspace
|
||||||
|
testdata/conf_reflect.ini
|
||||||
|
.idea
|
||||||
|
/.vscode
|
||||||
|
.DS_Store
|
|
@ -0,0 +1,27 @@
|
||||||
|
linters-settings:
|
||||||
|
staticcheck:
|
||||||
|
checks: [
|
||||||
|
"all",
|
||||||
|
"-SA1019" # There are valid use cases of strings.Title
|
||||||
|
]
|
||||||
|
nakedret:
|
||||||
|
max-func-lines: 0 # Disallow any unnamed return statement
|
||||||
|
|
||||||
|
linters:
|
||||||
|
enable:
|
||||||
|
- deadcode
|
||||||
|
- errcheck
|
||||||
|
- gosimple
|
||||||
|
- govet
|
||||||
|
- ineffassign
|
||||||
|
- staticcheck
|
||||||
|
- structcheck
|
||||||
|
- typecheck
|
||||||
|
- unused
|
||||||
|
- varcheck
|
||||||
|
- nakedret
|
||||||
|
- gofmt
|
||||||
|
- rowserrcheck
|
||||||
|
- unconvert
|
||||||
|
- goimports
|
||||||
|
- unparam
|
|
@ -0,0 +1,191 @@
|
||||||
|
Apache License
|
||||||
|
Version 2.0, January 2004
|
||||||
|
http://www.apache.org/licenses/
|
||||||
|
|
||||||
|
TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION
|
||||||
|
|
||||||
|
1. Definitions.
|
||||||
|
|
||||||
|
"License" shall mean the terms and conditions for use, reproduction, and
|
||||||
|
distribution as defined by Sections 1 through 9 of this document.
|
||||||
|
|
||||||
|
"Licensor" shall mean the copyright owner or entity authorized by the copyright
|
||||||
|
owner that is granting the License.
|
||||||
|
|
||||||
|
"Legal Entity" shall mean the union of the acting entity and all other entities
|
||||||
|
that control, are controlled by, or are under common control with that entity.
|
||||||
|
For the purposes of this definition, "control" means (i) the power, direct or
|
||||||
|
indirect, to cause the direction or management of such entity, whether by
|
||||||
|
contract or otherwise, or (ii) ownership of fifty percent (50%) or more of the
|
||||||
|
outstanding shares, or (iii) beneficial ownership of such entity.
|
||||||
|
|
||||||
|
"You" (or "Your") shall mean an individual or Legal Entity exercising
|
||||||
|
permissions granted by this License.
|
||||||
|
|
||||||
|
"Source" form shall mean the preferred form for making modifications, including
|
||||||
|
but not limited to software source code, documentation source, and configuration
|
||||||
|
files.
|
||||||
|
|
||||||
|
"Object" form shall mean any form resulting from mechanical transformation or
|
||||||
|
translation of a Source form, including but not limited to compiled object code,
|
||||||
|
generated documentation, and conversions to other media types.
|
||||||
|
|
||||||
|
"Work" shall mean the work of authorship, whether in Source or Object form, made
|
||||||
|
available under the License, as indicated by a copyright notice that is included
|
||||||
|
in or attached to the work (an example is provided in the Appendix below).
|
||||||
|
|
||||||
|
"Derivative Works" shall mean any work, whether in Source or Object form, that
|
||||||
|
is based on (or derived from) the Work and for which the editorial revisions,
|
||||||
|
annotations, elaborations, or other modifications represent, as a whole, an
|
||||||
|
original work of authorship. For the purposes of this License, Derivative Works
|
||||||
|
shall not include works that remain separable from, or merely link (or bind by
|
||||||
|
name) to the interfaces of, the Work and Derivative Works thereof.
|
||||||
|
|
||||||
|
"Contribution" shall mean any work of authorship, including the original version
|
||||||
|
of the Work and any modifications or additions to that Work or Derivative Works
|
||||||
|
thereof, that is intentionally submitted to Licensor for inclusion in the Work
|
||||||
|
by the copyright owner or by an individual or Legal Entity authorized to submit
|
||||||
|
on behalf of the copyright owner. For the purposes of this definition,
|
||||||
|
"submitted" means any form of electronic, verbal, or written communication sent
|
||||||
|
to the Licensor or its representatives, including but not limited to
|
||||||
|
communication on electronic mailing lists, source code control systems, and
|
||||||
|
issue tracking systems that are managed by, or on behalf of, the Licensor for
|
||||||
|
the purpose of discussing and improving the Work, but excluding communication
|
||||||
|
that is conspicuously marked or otherwise designated in writing by the copyright
|
||||||
|
owner as "Not a Contribution."
|
||||||
|
|
||||||
|
"Contributor" shall mean Licensor and any individual or Legal Entity on behalf
|
||||||
|
of whom a Contribution has been received by Licensor and subsequently
|
||||||
|
incorporated within the Work.
|
||||||
|
|
||||||
|
2. Grant of Copyright License.
|
||||||
|
|
||||||
|
Subject to the terms and conditions of this License, each Contributor hereby
|
||||||
|
grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free,
|
||||||
|
irrevocable copyright license to reproduce, prepare Derivative Works of,
|
||||||
|
publicly display, publicly perform, sublicense, and distribute the Work and such
|
||||||
|
Derivative Works in Source or Object form.
|
||||||
|
|
||||||
|
3. Grant of Patent License.
|
||||||
|
|
||||||
|
Subject to the terms and conditions of this License, each Contributor hereby
|
||||||
|
grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free,
|
||||||
|
irrevocable (except as stated in this section) patent license to make, have
|
||||||
|
made, use, offer to sell, sell, import, and otherwise transfer the Work, where
|
||||||
|
such license applies only to those patent claims licensable by such Contributor
|
||||||
|
that are necessarily infringed by their Contribution(s) alone or by combination
|
||||||
|
of their Contribution(s) with the Work to which such Contribution(s) was
|
||||||
|
submitted. If You institute patent litigation against any entity (including a
|
||||||
|
cross-claim or counterclaim in a lawsuit) alleging that the Work or a
|
||||||
|
Contribution incorporated within the Work constitutes direct or contributory
|
||||||
|
patent infringement, then any patent licenses granted to You under this License
|
||||||
|
for that Work shall terminate as of the date such litigation is filed.
|
||||||
|
|
||||||
|
4. Redistribution.
|
||||||
|
|
||||||
|
You may reproduce and distribute copies of the Work or Derivative Works thereof
|
||||||
|
in any medium, with or without modifications, and in Source or Object form,
|
||||||
|
provided that You meet the following conditions:
|
||||||
|
|
||||||
|
You must give any other recipients of the Work or Derivative Works a copy of
|
||||||
|
this License; and
|
||||||
|
You must cause any modified files to carry prominent notices stating that You
|
||||||
|
changed the files; and
|
||||||
|
You must retain, in the Source form of any Derivative Works that You distribute,
|
||||||
|
all copyright, patent, trademark, and attribution notices from the Source form
|
||||||
|
of the Work, excluding those notices that do not pertain to any part of the
|
||||||
|
Derivative Works; and
|
||||||
|
If the Work includes a "NOTICE" text file as part of its distribution, then any
|
||||||
|
Derivative Works that You distribute must include a readable copy of the
|
||||||
|
attribution notices contained within such NOTICE file, excluding those notices
|
||||||
|
that do not pertain to any part of the Derivative Works, in at least one of the
|
||||||
|
following places: within a NOTICE text file distributed as part of the
|
||||||
|
Derivative Works; within the Source form or documentation, if provided along
|
||||||
|
with the Derivative Works; or, within a display generated by the Derivative
|
||||||
|
Works, if and wherever such third-party notices normally appear. The contents of
|
||||||
|
the NOTICE file are for informational purposes only and do not modify the
|
||||||
|
License. You may add Your own attribution notices within Derivative Works that
|
||||||
|
You distribute, alongside or as an addendum to the NOTICE text from the Work,
|
||||||
|
provided that such additional attribution notices cannot be construed as
|
||||||
|
modifying the License.
|
||||||
|
You may add Your own copyright statement to Your modifications and may provide
|
||||||
|
additional or different license terms and conditions for use, reproduction, or
|
||||||
|
distribution of Your modifications, or for any such Derivative Works as a whole,
|
||||||
|
provided Your use, reproduction, and distribution of the Work otherwise complies
|
||||||
|
with the conditions stated in this License.
|
||||||
|
|
||||||
|
5. Submission of Contributions.
|
||||||
|
|
||||||
|
Unless You explicitly state otherwise, any Contribution intentionally submitted
|
||||||
|
for inclusion in the Work by You to the Licensor shall be under the terms and
|
||||||
|
conditions of this License, without any additional terms or conditions.
|
||||||
|
Notwithstanding the above, nothing herein shall supersede or modify the terms of
|
||||||
|
any separate license agreement you may have executed with Licensor regarding
|
||||||
|
such Contributions.
|
||||||
|
|
||||||
|
6. Trademarks.
|
||||||
|
|
||||||
|
This License does not grant permission to use the trade names, trademarks,
|
||||||
|
service marks, or product names of the Licensor, except as required for
|
||||||
|
reasonable and customary use in describing the origin of the Work and
|
||||||
|
reproducing the content of the NOTICE file.
|
||||||
|
|
||||||
|
7. Disclaimer of Warranty.
|
||||||
|
|
||||||
|
Unless required by applicable law or agreed to in writing, Licensor provides the
|
||||||
|
Work (and each Contributor provides its Contributions) on an "AS IS" BASIS,
|
||||||
|
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied,
|
||||||
|
including, without limitation, any warranties or conditions of TITLE,
|
||||||
|
NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A PARTICULAR PURPOSE. You are
|
||||||
|
solely responsible for determining the appropriateness of using or
|
||||||
|
redistributing the Work and assume any risks associated with Your exercise of
|
||||||
|
permissions under this License.
|
||||||
|
|
||||||
|
8. Limitation of Liability.
|
||||||
|
|
||||||
|
In no event and under no legal theory, whether in tort (including negligence),
|
||||||
|
contract, or otherwise, unless required by applicable law (such as deliberate
|
||||||
|
and grossly negligent acts) or agreed to in writing, shall any Contributor be
|
||||||
|
liable to You for damages, including any direct, indirect, special, incidental,
|
||||||
|
or consequential damages of any character arising as a result of this License or
|
||||||
|
out of the use or inability to use the Work (including but not limited to
|
||||||
|
damages for loss of goodwill, work stoppage, computer failure or malfunction, or
|
||||||
|
any and all other commercial damages or losses), even if such Contributor has
|
||||||
|
been advised of the possibility of such damages.
|
||||||
|
|
||||||
|
9. Accepting Warranty or Additional Liability.
|
||||||
|
|
||||||
|
While redistributing the Work or Derivative Works thereof, You may choose to
|
||||||
|
offer, and charge a fee for, acceptance of support, warranty, indemnity, or
|
||||||
|
other liability obligations and/or rights consistent with this License. However,
|
||||||
|
in accepting such obligations, You may act only on Your own behalf and on Your
|
||||||
|
sole responsibility, not on behalf of any other Contributor, and only if You
|
||||||
|
agree to indemnify, defend, and hold each Contributor harmless for any liability
|
||||||
|
incurred by, or claims asserted against, such Contributor by reason of your
|
||||||
|
accepting any such warranty or additional liability.
|
||||||
|
|
||||||
|
END OF TERMS AND CONDITIONS
|
||||||
|
|
||||||
|
APPENDIX: How to apply the Apache License to your work
|
||||||
|
|
||||||
|
To apply the Apache License to your work, attach the following boilerplate
|
||||||
|
notice, with the fields enclosed by brackets "[]" replaced with your own
|
||||||
|
identifying information. (Don't include the brackets!) The text should be
|
||||||
|
enclosed in the appropriate comment syntax for the file format. We also
|
||||||
|
recommend that a file or class name and description of purpose be included on
|
||||||
|
the same "printed page" as the copyright notice for easier identification within
|
||||||
|
third-party archives.
|
||||||
|
|
||||||
|
Copyright 2014 Unknwon
|
||||||
|
|
||||||
|
Licensed under the Apache License, Version 2.0 (the "License");
|
||||||
|
you may not use this file except in compliance with the License.
|
||||||
|
You may obtain a copy of the License at
|
||||||
|
|
||||||
|
http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
|
||||||
|
Unless required by applicable law or agreed to in writing, software
|
||||||
|
distributed under the License is distributed on an "AS IS" BASIS,
|
||||||
|
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||||
|
See the License for the specific language governing permissions and
|
||||||
|
limitations under the License.
|
|
@ -0,0 +1,15 @@
|
||||||
|
.PHONY: build test bench vet coverage
|
||||||
|
|
||||||
|
build: vet bench
|
||||||
|
|
||||||
|
test:
|
||||||
|
go test -v -cover -race
|
||||||
|
|
||||||
|
bench:
|
||||||
|
go test -v -cover -test.bench=. -test.benchmem
|
||||||
|
|
||||||
|
vet:
|
||||||
|
go vet
|
||||||
|
|
||||||
|
coverage:
|
||||||
|
go test -coverprofile=c.out && go tool cover -html=c.out && rm c.out
|
|
@ -0,0 +1,43 @@
|
||||||
|
# INI
|
||||||
|
|
||||||
|
[![GitHub Workflow Status](https://img.shields.io/github/checks-status/go-ini/ini/main?logo=github&style=for-the-badge)](https://github.com/go-ini/ini/actions?query=branch%3Amain)
|
||||||
|
[![codecov](https://img.shields.io/codecov/c/github/go-ini/ini/master?logo=codecov&style=for-the-badge)](https://codecov.io/gh/go-ini/ini)
|
||||||
|
[![GoDoc](https://img.shields.io/badge/GoDoc-Reference-blue?style=for-the-badge&logo=go)](https://pkg.go.dev/github.com/go-ini/ini?tab=doc)
|
||||||
|
[![Sourcegraph](https://img.shields.io/badge/view%20on-Sourcegraph-brightgreen.svg?style=for-the-badge&logo=sourcegraph)](https://sourcegraph.com/github.com/go-ini/ini)
|
||||||
|
|
||||||
|
![](https://avatars0.githubusercontent.com/u/10216035?v=3&s=200)
|
||||||
|
|
||||||
|
Package ini provides INI file read and write functionality in Go.
|
||||||
|
|
||||||
|
## Features
|
||||||
|
|
||||||
|
- Load from multiple data sources(file, `[]byte`, `io.Reader` and `io.ReadCloser`) with overwrites.
|
||||||
|
- Read with recursion values.
|
||||||
|
- Read with parent-child sections.
|
||||||
|
- Read with auto-increment key names.
|
||||||
|
- Read with multiple-line values.
|
||||||
|
- Read with tons of helper methods.
|
||||||
|
- Read and convert values to Go types.
|
||||||
|
- Read and **WRITE** comments of sections and keys.
|
||||||
|
- Manipulate sections, keys and comments with ease.
|
||||||
|
- Keep sections and keys in order as you parse and save.
|
||||||
|
|
||||||
|
## Installation
|
||||||
|
|
||||||
|
The minimum requirement of Go is **1.13**.
|
||||||
|
|
||||||
|
```sh
|
||||||
|
$ go get gopkg.in/ini.v1
|
||||||
|
```
|
||||||
|
|
||||||
|
Please add `-u` flag to update in the future.
|
||||||
|
|
||||||
|
## Getting Help
|
||||||
|
|
||||||
|
- [Getting Started](https://ini.unknwon.io/docs/intro/getting_started)
|
||||||
|
- [API Documentation](https://gowalker.org/gopkg.in/ini.v1)
|
||||||
|
- 中国大陆镜像:https://ini.unknwon.cn
|
||||||
|
|
||||||
|
## License
|
||||||
|
|
||||||
|
This project is under Apache v2 License. See the [LICENSE](LICENSE) file for the full license text.
|
|
@ -0,0 +1,16 @@
|
||||||
|
coverage:
|
||||||
|
range: "60...95"
|
||||||
|
status:
|
||||||
|
project:
|
||||||
|
default:
|
||||||
|
threshold: 1%
|
||||||
|
informational: true
|
||||||
|
patch:
|
||||||
|
defualt:
|
||||||
|
only_pulls: true
|
||||||
|
informational: true
|
||||||
|
|
||||||
|
comment:
|
||||||
|
layout: 'diff'
|
||||||
|
|
||||||
|
github_checks: false
|
|
@ -0,0 +1,76 @@
|
||||||
|
// Copyright 2019 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"bytes"
|
||||||
|
"fmt"
|
||||||
|
"io"
|
||||||
|
"io/ioutil"
|
||||||
|
"os"
|
||||||
|
)
|
||||||
|
|
||||||
|
var (
|
||||||
|
_ dataSource = (*sourceFile)(nil)
|
||||||
|
_ dataSource = (*sourceData)(nil)
|
||||||
|
_ dataSource = (*sourceReadCloser)(nil)
|
||||||
|
)
|
||||||
|
|
||||||
|
// dataSource is an interface that returns object which can be read and closed.
|
||||||
|
type dataSource interface {
|
||||||
|
ReadCloser() (io.ReadCloser, error)
|
||||||
|
}
|
||||||
|
|
||||||
|
// sourceFile represents an object that contains content on the local file system.
|
||||||
|
type sourceFile struct {
|
||||||
|
name string
|
||||||
|
}
|
||||||
|
|
||||||
|
func (s sourceFile) ReadCloser() (_ io.ReadCloser, err error) {
|
||||||
|
return os.Open(s.name)
|
||||||
|
}
|
||||||
|
|
||||||
|
// sourceData represents an object that contains content in memory.
|
||||||
|
type sourceData struct {
|
||||||
|
data []byte
|
||||||
|
}
|
||||||
|
|
||||||
|
func (s *sourceData) ReadCloser() (io.ReadCloser, error) {
|
||||||
|
return ioutil.NopCloser(bytes.NewReader(s.data)), nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// sourceReadCloser represents an input stream with Close method.
|
||||||
|
type sourceReadCloser struct {
|
||||||
|
reader io.ReadCloser
|
||||||
|
}
|
||||||
|
|
||||||
|
func (s *sourceReadCloser) ReadCloser() (io.ReadCloser, error) {
|
||||||
|
return s.reader, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func parseDataSource(source interface{}) (dataSource, error) {
|
||||||
|
switch s := source.(type) {
|
||||||
|
case string:
|
||||||
|
return sourceFile{s}, nil
|
||||||
|
case []byte:
|
||||||
|
return &sourceData{s}, nil
|
||||||
|
case io.ReadCloser:
|
||||||
|
return &sourceReadCloser{s}, nil
|
||||||
|
case io.Reader:
|
||||||
|
return &sourceReadCloser{ioutil.NopCloser(s)}, nil
|
||||||
|
default:
|
||||||
|
return nil, fmt.Errorf("error parsing data source: unknown type %q", s)
|
||||||
|
}
|
||||||
|
}
|
|
@ -0,0 +1,22 @@
|
||||||
|
// Copyright 2019 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
var (
|
||||||
|
// Deprecated: Use "DefaultSection" instead.
|
||||||
|
DEFAULT_SECTION = DefaultSection
|
||||||
|
// Deprecated: AllCapsUnderscore converts to format ALL_CAPS_UNDERSCORE.
|
||||||
|
AllCapsUnderscore = SnackCase
|
||||||
|
)
|
|
@ -0,0 +1,49 @@
|
||||||
|
// Copyright 2016 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"fmt"
|
||||||
|
)
|
||||||
|
|
||||||
|
// ErrDelimiterNotFound indicates the error type of no delimiter is found which there should be one.
|
||||||
|
type ErrDelimiterNotFound struct {
|
||||||
|
Line string
|
||||||
|
}
|
||||||
|
|
||||||
|
// IsErrDelimiterNotFound returns true if the given error is an instance of ErrDelimiterNotFound.
|
||||||
|
func IsErrDelimiterNotFound(err error) bool {
|
||||||
|
_, ok := err.(ErrDelimiterNotFound)
|
||||||
|
return ok
|
||||||
|
}
|
||||||
|
|
||||||
|
func (err ErrDelimiterNotFound) Error() string {
|
||||||
|
return fmt.Sprintf("key-value delimiter not found: %s", err.Line)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ErrEmptyKeyName indicates the error type of no key name is found which there should be one.
|
||||||
|
type ErrEmptyKeyName struct {
|
||||||
|
Line string
|
||||||
|
}
|
||||||
|
|
||||||
|
// IsErrEmptyKeyName returns true if the given error is an instance of ErrEmptyKeyName.
|
||||||
|
func IsErrEmptyKeyName(err error) bool {
|
||||||
|
_, ok := err.(ErrEmptyKeyName)
|
||||||
|
return ok
|
||||||
|
}
|
||||||
|
|
||||||
|
func (err ErrEmptyKeyName) Error() string {
|
||||||
|
return fmt.Sprintf("empty key name: %s", err.Line)
|
||||||
|
}
|
|
@ -0,0 +1,541 @@
|
||||||
|
// Copyright 2017 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"bytes"
|
||||||
|
"errors"
|
||||||
|
"fmt"
|
||||||
|
"io"
|
||||||
|
"io/ioutil"
|
||||||
|
"os"
|
||||||
|
"strings"
|
||||||
|
"sync"
|
||||||
|
)
|
||||||
|
|
||||||
|
// File represents a combination of one or more INI files in memory.
|
||||||
|
type File struct {
|
||||||
|
options LoadOptions
|
||||||
|
dataSources []dataSource
|
||||||
|
|
||||||
|
// Should make things safe, but sometimes doesn't matter.
|
||||||
|
BlockMode bool
|
||||||
|
lock sync.RWMutex
|
||||||
|
|
||||||
|
// To keep data in order.
|
||||||
|
sectionList []string
|
||||||
|
// To keep track of the index of a section with same name.
|
||||||
|
// This meta list is only used with non-unique section names are allowed.
|
||||||
|
sectionIndexes []int
|
||||||
|
|
||||||
|
// Actual data is stored here.
|
||||||
|
sections map[string][]*Section
|
||||||
|
|
||||||
|
NameMapper
|
||||||
|
ValueMapper
|
||||||
|
}
|
||||||
|
|
||||||
|
// newFile initializes File object with given data sources.
|
||||||
|
func newFile(dataSources []dataSource, opts LoadOptions) *File {
|
||||||
|
if len(opts.KeyValueDelimiters) == 0 {
|
||||||
|
opts.KeyValueDelimiters = "=:"
|
||||||
|
}
|
||||||
|
if len(opts.KeyValueDelimiterOnWrite) == 0 {
|
||||||
|
opts.KeyValueDelimiterOnWrite = "="
|
||||||
|
}
|
||||||
|
if len(opts.ChildSectionDelimiter) == 0 {
|
||||||
|
opts.ChildSectionDelimiter = "."
|
||||||
|
}
|
||||||
|
|
||||||
|
return &File{
|
||||||
|
BlockMode: true,
|
||||||
|
dataSources: dataSources,
|
||||||
|
sections: make(map[string][]*Section),
|
||||||
|
options: opts,
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// Empty returns an empty file object.
|
||||||
|
func Empty(opts ...LoadOptions) *File {
|
||||||
|
var opt LoadOptions
|
||||||
|
if len(opts) > 0 {
|
||||||
|
opt = opts[0]
|
||||||
|
}
|
||||||
|
|
||||||
|
// Ignore error here, we are sure our data is good.
|
||||||
|
f, _ := LoadSources(opt, []byte(""))
|
||||||
|
return f
|
||||||
|
}
|
||||||
|
|
||||||
|
// NewSection creates a new section.
|
||||||
|
func (f *File) NewSection(name string) (*Section, error) {
|
||||||
|
if len(name) == 0 {
|
||||||
|
return nil, errors.New("empty section name")
|
||||||
|
}
|
||||||
|
|
||||||
|
if (f.options.Insensitive || f.options.InsensitiveSections) && name != DefaultSection {
|
||||||
|
name = strings.ToLower(name)
|
||||||
|
}
|
||||||
|
|
||||||
|
if f.BlockMode {
|
||||||
|
f.lock.Lock()
|
||||||
|
defer f.lock.Unlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
if !f.options.AllowNonUniqueSections && inSlice(name, f.sectionList) {
|
||||||
|
return f.sections[name][0], nil
|
||||||
|
}
|
||||||
|
|
||||||
|
f.sectionList = append(f.sectionList, name)
|
||||||
|
|
||||||
|
// NOTE: Append to indexes must happen before appending to sections,
|
||||||
|
// otherwise index will have off-by-one problem.
|
||||||
|
f.sectionIndexes = append(f.sectionIndexes, len(f.sections[name]))
|
||||||
|
|
||||||
|
sec := newSection(f, name)
|
||||||
|
f.sections[name] = append(f.sections[name], sec)
|
||||||
|
|
||||||
|
return sec, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// NewRawSection creates a new section with an unparseable body.
|
||||||
|
func (f *File) NewRawSection(name, body string) (*Section, error) {
|
||||||
|
section, err := f.NewSection(name)
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
|
||||||
|
section.isRawSection = true
|
||||||
|
section.rawBody = body
|
||||||
|
return section, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// NewSections creates a list of sections.
|
||||||
|
func (f *File) NewSections(names ...string) (err error) {
|
||||||
|
for _, name := range names {
|
||||||
|
if _, err = f.NewSection(name); err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// GetSection returns section by given name.
|
||||||
|
func (f *File) GetSection(name string) (*Section, error) {
|
||||||
|
secs, err := f.SectionsByName(name)
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
|
||||||
|
return secs[0], err
|
||||||
|
}
|
||||||
|
|
||||||
|
// HasSection returns true if the file contains a section with given name.
|
||||||
|
func (f *File) HasSection(name string) bool {
|
||||||
|
section, _ := f.GetSection(name)
|
||||||
|
return section != nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// SectionsByName returns all sections with given name.
|
||||||
|
func (f *File) SectionsByName(name string) ([]*Section, error) {
|
||||||
|
if len(name) == 0 {
|
||||||
|
name = DefaultSection
|
||||||
|
}
|
||||||
|
if f.options.Insensitive || f.options.InsensitiveSections {
|
||||||
|
name = strings.ToLower(name)
|
||||||
|
}
|
||||||
|
|
||||||
|
if f.BlockMode {
|
||||||
|
f.lock.RLock()
|
||||||
|
defer f.lock.RUnlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
secs := f.sections[name]
|
||||||
|
if len(secs) == 0 {
|
||||||
|
return nil, fmt.Errorf("section %q does not exist", name)
|
||||||
|
}
|
||||||
|
|
||||||
|
return secs, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Section assumes named section exists and returns a zero-value when not.
|
||||||
|
func (f *File) Section(name string) *Section {
|
||||||
|
sec, err := f.GetSection(name)
|
||||||
|
if err != nil {
|
||||||
|
if name == "" {
|
||||||
|
name = DefaultSection
|
||||||
|
}
|
||||||
|
sec, _ = f.NewSection(name)
|
||||||
|
return sec
|
||||||
|
}
|
||||||
|
return sec
|
||||||
|
}
|
||||||
|
|
||||||
|
// SectionWithIndex assumes named section exists and returns a new section when not.
|
||||||
|
func (f *File) SectionWithIndex(name string, index int) *Section {
|
||||||
|
secs, err := f.SectionsByName(name)
|
||||||
|
if err != nil || len(secs) <= index {
|
||||||
|
// NOTE: It's OK here because the only possible error is empty section name,
|
||||||
|
// but if it's empty, this piece of code won't be executed.
|
||||||
|
newSec, _ := f.NewSection(name)
|
||||||
|
return newSec
|
||||||
|
}
|
||||||
|
|
||||||
|
return secs[index]
|
||||||
|
}
|
||||||
|
|
||||||
|
// Sections returns a list of Section stored in the current instance.
|
||||||
|
func (f *File) Sections() []*Section {
|
||||||
|
if f.BlockMode {
|
||||||
|
f.lock.RLock()
|
||||||
|
defer f.lock.RUnlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
sections := make([]*Section, len(f.sectionList))
|
||||||
|
for i, name := range f.sectionList {
|
||||||
|
sections[i] = f.sections[name][f.sectionIndexes[i]]
|
||||||
|
}
|
||||||
|
return sections
|
||||||
|
}
|
||||||
|
|
||||||
|
// ChildSections returns a list of child sections of given section name.
|
||||||
|
func (f *File) ChildSections(name string) []*Section {
|
||||||
|
return f.Section(name).ChildSections()
|
||||||
|
}
|
||||||
|
|
||||||
|
// SectionStrings returns list of section names.
|
||||||
|
func (f *File) SectionStrings() []string {
|
||||||
|
list := make([]string, len(f.sectionList))
|
||||||
|
copy(list, f.sectionList)
|
||||||
|
return list
|
||||||
|
}
|
||||||
|
|
||||||
|
// DeleteSection deletes a section or all sections with given name.
|
||||||
|
func (f *File) DeleteSection(name string) {
|
||||||
|
secs, err := f.SectionsByName(name)
|
||||||
|
if err != nil {
|
||||||
|
return
|
||||||
|
}
|
||||||
|
|
||||||
|
for i := 0; i < len(secs); i++ {
|
||||||
|
// For non-unique sections, it is always needed to remove the first one so
|
||||||
|
// in the next iteration, the subsequent section continue having index 0.
|
||||||
|
// Ignoring the error as index 0 never returns an error.
|
||||||
|
_ = f.DeleteSectionWithIndex(name, 0)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// DeleteSectionWithIndex deletes a section with given name and index.
|
||||||
|
func (f *File) DeleteSectionWithIndex(name string, index int) error {
|
||||||
|
if !f.options.AllowNonUniqueSections && index != 0 {
|
||||||
|
return fmt.Errorf("delete section with non-zero index is only allowed when non-unique sections is enabled")
|
||||||
|
}
|
||||||
|
|
||||||
|
if len(name) == 0 {
|
||||||
|
name = DefaultSection
|
||||||
|
}
|
||||||
|
if f.options.Insensitive || f.options.InsensitiveSections {
|
||||||
|
name = strings.ToLower(name)
|
||||||
|
}
|
||||||
|
|
||||||
|
if f.BlockMode {
|
||||||
|
f.lock.Lock()
|
||||||
|
defer f.lock.Unlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
// Count occurrences of the sections
|
||||||
|
occurrences := 0
|
||||||
|
|
||||||
|
sectionListCopy := make([]string, len(f.sectionList))
|
||||||
|
copy(sectionListCopy, f.sectionList)
|
||||||
|
|
||||||
|
for i, s := range sectionListCopy {
|
||||||
|
if s != name {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if occurrences == index {
|
||||||
|
if len(f.sections[name]) <= 1 {
|
||||||
|
delete(f.sections, name) // The last one in the map
|
||||||
|
} else {
|
||||||
|
f.sections[name] = append(f.sections[name][:index], f.sections[name][index+1:]...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Fix section lists
|
||||||
|
f.sectionList = append(f.sectionList[:i], f.sectionList[i+1:]...)
|
||||||
|
f.sectionIndexes = append(f.sectionIndexes[:i], f.sectionIndexes[i+1:]...)
|
||||||
|
|
||||||
|
} else if occurrences > index {
|
||||||
|
// Fix the indices of all following sections with this name.
|
||||||
|
f.sectionIndexes[i-1]--
|
||||||
|
}
|
||||||
|
|
||||||
|
occurrences++
|
||||||
|
}
|
||||||
|
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func (f *File) reload(s dataSource) error {
|
||||||
|
r, err := s.ReadCloser()
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
defer r.Close()
|
||||||
|
|
||||||
|
return f.parse(r)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Reload reloads and parses all data sources.
|
||||||
|
func (f *File) Reload() (err error) {
|
||||||
|
for _, s := range f.dataSources {
|
||||||
|
if err = f.reload(s); err != nil {
|
||||||
|
// In loose mode, we create an empty default section for nonexistent files.
|
||||||
|
if os.IsNotExist(err) && f.options.Loose {
|
||||||
|
_ = f.parse(bytes.NewBuffer(nil))
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
if f.options.ShortCircuit {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Append appends one or more data sources and reloads automatically.
|
||||||
|
func (f *File) Append(source interface{}, others ...interface{}) error {
|
||||||
|
ds, err := parseDataSource(source)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
f.dataSources = append(f.dataSources, ds)
|
||||||
|
for _, s := range others {
|
||||||
|
ds, err = parseDataSource(s)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
f.dataSources = append(f.dataSources, ds)
|
||||||
|
}
|
||||||
|
return f.Reload()
|
||||||
|
}
|
||||||
|
|
||||||
|
func (f *File) writeToBuffer(indent string) (*bytes.Buffer, error) {
|
||||||
|
equalSign := DefaultFormatLeft + f.options.KeyValueDelimiterOnWrite + DefaultFormatRight
|
||||||
|
|
||||||
|
if PrettyFormat || PrettyEqual {
|
||||||
|
equalSign = fmt.Sprintf(" %s ", f.options.KeyValueDelimiterOnWrite)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Use buffer to make sure target is safe until finish encoding.
|
||||||
|
buf := bytes.NewBuffer(nil)
|
||||||
|
lastSectionIdx := len(f.sectionList) - 1
|
||||||
|
for i, sname := range f.sectionList {
|
||||||
|
sec := f.SectionWithIndex(sname, f.sectionIndexes[i])
|
||||||
|
if len(sec.Comment) > 0 {
|
||||||
|
// Support multiline comments
|
||||||
|
lines := strings.Split(sec.Comment, LineBreak)
|
||||||
|
for i := range lines {
|
||||||
|
if lines[i][0] != '#' && lines[i][0] != ';' {
|
||||||
|
lines[i] = "; " + lines[i]
|
||||||
|
} else {
|
||||||
|
lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:])
|
||||||
|
}
|
||||||
|
|
||||||
|
if _, err := buf.WriteString(lines[i] + LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
if i > 0 || DefaultHeader || (i == 0 && strings.ToUpper(sec.name) != DefaultSection) {
|
||||||
|
if _, err := buf.WriteString("[" + sname + "]" + LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
} else {
|
||||||
|
// Write nothing if default section is empty
|
||||||
|
if len(sec.keyList) == 0 {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
isLastSection := i == lastSectionIdx
|
||||||
|
if sec.isRawSection {
|
||||||
|
if _, err := buf.WriteString(sec.rawBody); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
|
||||||
|
if PrettySection && !isLastSection {
|
||||||
|
// Put a line between sections
|
||||||
|
if _, err := buf.WriteString(LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
// Count and generate alignment length and buffer spaces using the
|
||||||
|
// longest key. Keys may be modified if they contain certain characters so
|
||||||
|
// we need to take that into account in our calculation.
|
||||||
|
alignLength := 0
|
||||||
|
if PrettyFormat {
|
||||||
|
for _, kname := range sec.keyList {
|
||||||
|
keyLength := len(kname)
|
||||||
|
// First case will surround key by ` and second by """
|
||||||
|
if strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters) {
|
||||||
|
keyLength += 2
|
||||||
|
} else if strings.Contains(kname, "`") {
|
||||||
|
keyLength += 6
|
||||||
|
}
|
||||||
|
|
||||||
|
if keyLength > alignLength {
|
||||||
|
alignLength = keyLength
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
alignSpaces := bytes.Repeat([]byte(" "), alignLength)
|
||||||
|
|
||||||
|
KeyList:
|
||||||
|
for _, kname := range sec.keyList {
|
||||||
|
key := sec.Key(kname)
|
||||||
|
if len(key.Comment) > 0 {
|
||||||
|
if len(indent) > 0 && sname != DefaultSection {
|
||||||
|
buf.WriteString(indent)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Support multiline comments
|
||||||
|
lines := strings.Split(key.Comment, LineBreak)
|
||||||
|
for i := range lines {
|
||||||
|
if lines[i][0] != '#' && lines[i][0] != ';' {
|
||||||
|
lines[i] = "; " + strings.TrimSpace(lines[i])
|
||||||
|
} else {
|
||||||
|
lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:])
|
||||||
|
}
|
||||||
|
|
||||||
|
if _, err := buf.WriteString(lines[i] + LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
if len(indent) > 0 && sname != DefaultSection {
|
||||||
|
buf.WriteString(indent)
|
||||||
|
}
|
||||||
|
|
||||||
|
switch {
|
||||||
|
case key.isAutoIncrement:
|
||||||
|
kname = "-"
|
||||||
|
case strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters):
|
||||||
|
kname = "`" + kname + "`"
|
||||||
|
case strings.Contains(kname, "`"):
|
||||||
|
kname = `"""` + kname + `"""`
|
||||||
|
}
|
||||||
|
|
||||||
|
writeKeyValue := func(val string) (bool, error) {
|
||||||
|
if _, err := buf.WriteString(kname); err != nil {
|
||||||
|
return false, err
|
||||||
|
}
|
||||||
|
|
||||||
|
if key.isBooleanType {
|
||||||
|
buf.WriteString(LineBreak)
|
||||||
|
return true, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Write out alignment spaces before "=" sign
|
||||||
|
if PrettyFormat {
|
||||||
|
buf.Write(alignSpaces[:alignLength-len(kname)])
|
||||||
|
}
|
||||||
|
|
||||||
|
// In case key value contains "\n", "`", "\"", "#" or ";"
|
||||||
|
if strings.ContainsAny(val, "\n`") {
|
||||||
|
val = `"""` + val + `"""`
|
||||||
|
} else if !f.options.IgnoreInlineComment && strings.ContainsAny(val, "#;") {
|
||||||
|
val = "`" + val + "`"
|
||||||
|
} else if len(strings.TrimSpace(val)) != len(val) {
|
||||||
|
val = `"` + val + `"`
|
||||||
|
}
|
||||||
|
if _, err := buf.WriteString(equalSign + val + LineBreak); err != nil {
|
||||||
|
return false, err
|
||||||
|
}
|
||||||
|
return false, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
shadows := key.ValueWithShadows()
|
||||||
|
if len(shadows) == 0 {
|
||||||
|
if _, err := writeKeyValue(""); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
for _, val := range shadows {
|
||||||
|
exitLoop, err := writeKeyValue(val)
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
} else if exitLoop {
|
||||||
|
continue KeyList
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
for _, val := range key.nestedValues {
|
||||||
|
if _, err := buf.WriteString(indent + " " + val + LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
if PrettySection && !isLastSection {
|
||||||
|
// Put a line between sections
|
||||||
|
if _, err := buf.WriteString(LineBreak); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
return buf, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// WriteToIndent writes content into io.Writer with given indention.
|
||||||
|
// If PrettyFormat has been set to be true,
|
||||||
|
// it will align "=" sign with spaces under each section.
|
||||||
|
func (f *File) WriteToIndent(w io.Writer, indent string) (int64, error) {
|
||||||
|
buf, err := f.writeToBuffer(indent)
|
||||||
|
if err != nil {
|
||||||
|
return 0, err
|
||||||
|
}
|
||||||
|
return buf.WriteTo(w)
|
||||||
|
}
|
||||||
|
|
||||||
|
// WriteTo writes file content into io.Writer.
|
||||||
|
func (f *File) WriteTo(w io.Writer) (int64, error) {
|
||||||
|
return f.WriteToIndent(w, "")
|
||||||
|
}
|
||||||
|
|
||||||
|
// SaveToIndent writes content to file system with given value indention.
|
||||||
|
func (f *File) SaveToIndent(filename, indent string) error {
|
||||||
|
// Note: Because we are truncating with os.Create,
|
||||||
|
// so it's safer to save to a temporary file location and rename after done.
|
||||||
|
buf, err := f.writeToBuffer(indent)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
return ioutil.WriteFile(filename, buf.Bytes(), 0666)
|
||||||
|
}
|
||||||
|
|
||||||
|
// SaveTo writes content to file system.
|
||||||
|
func (f *File) SaveTo(filename string) error {
|
||||||
|
return f.SaveToIndent(filename, "")
|
||||||
|
}
|
|
@ -0,0 +1,24 @@
|
||||||
|
// Copyright 2019 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
func inSlice(str string, s []string) bool {
|
||||||
|
for _, v := range s {
|
||||||
|
if str == v {
|
||||||
|
return true
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return false
|
||||||
|
}
|
|
@ -0,0 +1,176 @@
|
||||||
|
// Copyright 2014 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
// Package ini provides INI file read and write functionality in Go.
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"os"
|
||||||
|
"regexp"
|
||||||
|
"runtime"
|
||||||
|
"strings"
|
||||||
|
)
|
||||||
|
|
||||||
|
const (
|
||||||
|
// Maximum allowed depth when recursively substituing variable names.
|
||||||
|
depthValues = 99
|
||||||
|
)
|
||||||
|
|
||||||
|
var (
|
||||||
|
// DefaultSection is the name of default section. You can use this var or the string literal.
|
||||||
|
// In most of cases, an empty string is all you need to access the section.
|
||||||
|
DefaultSection = "DEFAULT"
|
||||||
|
|
||||||
|
// LineBreak is the delimiter to determine or compose a new line.
|
||||||
|
// This variable will be changed to "\r\n" automatically on Windows at package init time.
|
||||||
|
LineBreak = "\n"
|
||||||
|
|
||||||
|
// Variable regexp pattern: %(variable)s
|
||||||
|
varPattern = regexp.MustCompile(`%\(([^)]+)\)s`)
|
||||||
|
|
||||||
|
// DefaultHeader explicitly writes default section header.
|
||||||
|
DefaultHeader = false
|
||||||
|
|
||||||
|
// PrettySection indicates whether to put a line between sections.
|
||||||
|
PrettySection = true
|
||||||
|
// PrettyFormat indicates whether to align "=" sign with spaces to produce pretty output
|
||||||
|
// or reduce all possible spaces for compact format.
|
||||||
|
PrettyFormat = true
|
||||||
|
// PrettyEqual places spaces around "=" sign even when PrettyFormat is false.
|
||||||
|
PrettyEqual = false
|
||||||
|
// DefaultFormatLeft places custom spaces on the left when PrettyFormat and PrettyEqual are both disabled.
|
||||||
|
DefaultFormatLeft = ""
|
||||||
|
// DefaultFormatRight places custom spaces on the right when PrettyFormat and PrettyEqual are both disabled.
|
||||||
|
DefaultFormatRight = ""
|
||||||
|
)
|
||||||
|
|
||||||
|
var inTest = len(os.Args) > 0 && strings.HasSuffix(strings.TrimSuffix(os.Args[0], ".exe"), ".test")
|
||||||
|
|
||||||
|
func init() {
|
||||||
|
if runtime.GOOS == "windows" && !inTest {
|
||||||
|
LineBreak = "\r\n"
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// LoadOptions contains all customized options used for load data source(s).
|
||||||
|
type LoadOptions struct {
|
||||||
|
// Loose indicates whether the parser should ignore nonexistent files or return error.
|
||||||
|
Loose bool
|
||||||
|
// Insensitive indicates whether the parser forces all section and key names to lowercase.
|
||||||
|
Insensitive bool
|
||||||
|
// InsensitiveSections indicates whether the parser forces all section to lowercase.
|
||||||
|
InsensitiveSections bool
|
||||||
|
// InsensitiveKeys indicates whether the parser forces all key names to lowercase.
|
||||||
|
InsensitiveKeys bool
|
||||||
|
// IgnoreContinuation indicates whether to ignore continuation lines while parsing.
|
||||||
|
IgnoreContinuation bool
|
||||||
|
// IgnoreInlineComment indicates whether to ignore comments at the end of value and treat it as part of value.
|
||||||
|
IgnoreInlineComment bool
|
||||||
|
// SkipUnrecognizableLines indicates whether to skip unrecognizable lines that do not conform to key/value pairs.
|
||||||
|
SkipUnrecognizableLines bool
|
||||||
|
// ShortCircuit indicates whether to ignore other configuration sources after loaded the first available configuration source.
|
||||||
|
ShortCircuit bool
|
||||||
|
// AllowBooleanKeys indicates whether to allow boolean type keys or treat as value is missing.
|
||||||
|
// This type of keys are mostly used in my.cnf.
|
||||||
|
AllowBooleanKeys bool
|
||||||
|
// AllowShadows indicates whether to keep track of keys with same name under same section.
|
||||||
|
AllowShadows bool
|
||||||
|
// AllowNestedValues indicates whether to allow AWS-like nested values.
|
||||||
|
// Docs: http://docs.aws.amazon.com/cli/latest/topic/config-vars.html#nested-values
|
||||||
|
AllowNestedValues bool
|
||||||
|
// AllowPythonMultilineValues indicates whether to allow Python-like multi-line values.
|
||||||
|
// Docs: https://docs.python.org/3/library/configparser.html#supported-ini-file-structure
|
||||||
|
// Relevant quote: Values can also span multiple lines, as long as they are indented deeper
|
||||||
|
// than the first line of the value.
|
||||||
|
AllowPythonMultilineValues bool
|
||||||
|
// SpaceBeforeInlineComment indicates whether to allow comment symbols (\# and \;) inside value.
|
||||||
|
// Docs: https://docs.python.org/2/library/configparser.html
|
||||||
|
// Quote: Comments may appear on their own in an otherwise empty line, or may be entered in lines holding values or section names.
|
||||||
|
// In the latter case, they need to be preceded by a whitespace character to be recognized as a comment.
|
||||||
|
SpaceBeforeInlineComment bool
|
||||||
|
// UnescapeValueDoubleQuotes indicates whether to unescape double quotes inside value to regular format
|
||||||
|
// when value is surrounded by double quotes, e.g. key="a \"value\"" => key=a "value"
|
||||||
|
UnescapeValueDoubleQuotes bool
|
||||||
|
// UnescapeValueCommentSymbols indicates to unescape comment symbols (\# and \;) inside value to regular format
|
||||||
|
// when value is NOT surrounded by any quotes.
|
||||||
|
// Note: UNSTABLE, behavior might change to only unescape inside double quotes but may noy necessary at all.
|
||||||
|
UnescapeValueCommentSymbols bool
|
||||||
|
// UnparseableSections stores a list of blocks that are allowed with raw content which do not otherwise
|
||||||
|
// conform to key/value pairs. Specify the names of those blocks here.
|
||||||
|
UnparseableSections []string
|
||||||
|
// KeyValueDelimiters is the sequence of delimiters that are used to separate key and value. By default, it is "=:".
|
||||||
|
KeyValueDelimiters string
|
||||||
|
// KeyValueDelimiterOnWrite is the delimiter that are used to separate key and value output. By default, it is "=".
|
||||||
|
KeyValueDelimiterOnWrite string
|
||||||
|
// ChildSectionDelimiter is the delimiter that is used to separate child sections. By default, it is ".".
|
||||||
|
ChildSectionDelimiter string
|
||||||
|
// PreserveSurroundedQuote indicates whether to preserve surrounded quote (single and double quotes).
|
||||||
|
PreserveSurroundedQuote bool
|
||||||
|
// DebugFunc is called to collect debug information (currently only useful to debug parsing Python-style multiline values).
|
||||||
|
DebugFunc DebugFunc
|
||||||
|
// ReaderBufferSize is the buffer size of the reader in bytes.
|
||||||
|
ReaderBufferSize int
|
||||||
|
// AllowNonUniqueSections indicates whether to allow sections with the same name multiple times.
|
||||||
|
AllowNonUniqueSections bool
|
||||||
|
// AllowDuplicateShadowValues indicates whether values for shadowed keys should be deduplicated.
|
||||||
|
AllowDuplicateShadowValues bool
|
||||||
|
}
|
||||||
|
|
||||||
|
// DebugFunc is the type of function called to log parse events.
|
||||||
|
type DebugFunc func(message string)
|
||||||
|
|
||||||
|
// LoadSources allows caller to apply customized options for loading from data source(s).
|
||||||
|
func LoadSources(opts LoadOptions, source interface{}, others ...interface{}) (_ *File, err error) {
|
||||||
|
sources := make([]dataSource, len(others)+1)
|
||||||
|
sources[0], err = parseDataSource(source)
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
for i := range others {
|
||||||
|
sources[i+1], err = parseDataSource(others[i])
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
f := newFile(sources, opts)
|
||||||
|
if err = f.Reload(); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
return f, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Load loads and parses from INI data sources.
|
||||||
|
// Arguments can be mixed of file name with string type, or raw data in []byte.
|
||||||
|
// It will return error if list contains nonexistent files.
|
||||||
|
func Load(source interface{}, others ...interface{}) (*File, error) {
|
||||||
|
return LoadSources(LoadOptions{}, source, others...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// LooseLoad has exactly same functionality as Load function
|
||||||
|
// except it ignores nonexistent files instead of returning error.
|
||||||
|
func LooseLoad(source interface{}, others ...interface{}) (*File, error) {
|
||||||
|
return LoadSources(LoadOptions{Loose: true}, source, others...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// InsensitiveLoad has exactly same functionality as Load function
|
||||||
|
// except it forces all section and key names to be lowercased.
|
||||||
|
func InsensitiveLoad(source interface{}, others ...interface{}) (*File, error) {
|
||||||
|
return LoadSources(LoadOptions{Insensitive: true}, source, others...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ShadowLoad has exactly same functionality as Load function
|
||||||
|
// except it allows have shadow keys.
|
||||||
|
func ShadowLoad(source interface{}, others ...interface{}) (*File, error) {
|
||||||
|
return LoadSources(LoadOptions{AllowShadows: true}, source, others...)
|
||||||
|
}
|
|
@ -0,0 +1,837 @@
|
||||||
|
// Copyright 2014 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"bytes"
|
||||||
|
"errors"
|
||||||
|
"fmt"
|
||||||
|
"strconv"
|
||||||
|
"strings"
|
||||||
|
"time"
|
||||||
|
)
|
||||||
|
|
||||||
|
// Key represents a key under a section.
|
||||||
|
type Key struct {
|
||||||
|
s *Section
|
||||||
|
Comment string
|
||||||
|
name string
|
||||||
|
value string
|
||||||
|
isAutoIncrement bool
|
||||||
|
isBooleanType bool
|
||||||
|
|
||||||
|
isShadow bool
|
||||||
|
shadows []*Key
|
||||||
|
|
||||||
|
nestedValues []string
|
||||||
|
}
|
||||||
|
|
||||||
|
// newKey simply return a key object with given values.
|
||||||
|
func newKey(s *Section, name, val string) *Key {
|
||||||
|
return &Key{
|
||||||
|
s: s,
|
||||||
|
name: name,
|
||||||
|
value: val,
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
func (k *Key) addShadow(val string) error {
|
||||||
|
if k.isShadow {
|
||||||
|
return errors.New("cannot add shadow to another shadow key")
|
||||||
|
} else if k.isAutoIncrement || k.isBooleanType {
|
||||||
|
return errors.New("cannot add shadow to auto-increment or boolean key")
|
||||||
|
}
|
||||||
|
|
||||||
|
if !k.s.f.options.AllowDuplicateShadowValues {
|
||||||
|
// Deduplicate shadows based on their values.
|
||||||
|
if k.value == val {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
for i := range k.shadows {
|
||||||
|
if k.shadows[i].value == val {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
shadow := newKey(k.s, k.name, val)
|
||||||
|
shadow.isShadow = true
|
||||||
|
k.shadows = append(k.shadows, shadow)
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// AddShadow adds a new shadow key to itself.
|
||||||
|
func (k *Key) AddShadow(val string) error {
|
||||||
|
if !k.s.f.options.AllowShadows {
|
||||||
|
return errors.New("shadow key is not allowed")
|
||||||
|
}
|
||||||
|
return k.addShadow(val)
|
||||||
|
}
|
||||||
|
|
||||||
|
func (k *Key) addNestedValue(val string) error {
|
||||||
|
if k.isAutoIncrement || k.isBooleanType {
|
||||||
|
return errors.New("cannot add nested value to auto-increment or boolean key")
|
||||||
|
}
|
||||||
|
|
||||||
|
k.nestedValues = append(k.nestedValues, val)
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// AddNestedValue adds a nested value to the key.
|
||||||
|
func (k *Key) AddNestedValue(val string) error {
|
||||||
|
if !k.s.f.options.AllowNestedValues {
|
||||||
|
return errors.New("nested value is not allowed")
|
||||||
|
}
|
||||||
|
return k.addNestedValue(val)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValueMapper represents a mapping function for values, e.g. os.ExpandEnv
|
||||||
|
type ValueMapper func(string) string
|
||||||
|
|
||||||
|
// Name returns name of key.
|
||||||
|
func (k *Key) Name() string {
|
||||||
|
return k.name
|
||||||
|
}
|
||||||
|
|
||||||
|
// Value returns raw value of key for performance purpose.
|
||||||
|
func (k *Key) Value() string {
|
||||||
|
return k.value
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValueWithShadows returns raw values of key and its shadows if any. Shadow
|
||||||
|
// keys with empty values are ignored from the returned list.
|
||||||
|
func (k *Key) ValueWithShadows() []string {
|
||||||
|
if len(k.shadows) == 0 {
|
||||||
|
if k.value == "" {
|
||||||
|
return []string{}
|
||||||
|
}
|
||||||
|
return []string{k.value}
|
||||||
|
}
|
||||||
|
|
||||||
|
vals := make([]string, 0, len(k.shadows)+1)
|
||||||
|
if k.value != "" {
|
||||||
|
vals = append(vals, k.value)
|
||||||
|
}
|
||||||
|
for _, s := range k.shadows {
|
||||||
|
if s.value != "" {
|
||||||
|
vals = append(vals, s.value)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// NestedValues returns nested values stored in the key.
|
||||||
|
// It is possible returned value is nil if no nested values stored in the key.
|
||||||
|
func (k *Key) NestedValues() []string {
|
||||||
|
return k.nestedValues
|
||||||
|
}
|
||||||
|
|
||||||
|
// transformValue takes a raw value and transforms to its final string.
|
||||||
|
func (k *Key) transformValue(val string) string {
|
||||||
|
if k.s.f.ValueMapper != nil {
|
||||||
|
val = k.s.f.ValueMapper(val)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Fail-fast if no indicate char found for recursive value
|
||||||
|
if !strings.Contains(val, "%") {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
for i := 0; i < depthValues; i++ {
|
||||||
|
vr := varPattern.FindString(val)
|
||||||
|
if len(vr) == 0 {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
|
||||||
|
// Take off leading '%(' and trailing ')s'.
|
||||||
|
noption := vr[2 : len(vr)-2]
|
||||||
|
|
||||||
|
// Search in the same section.
|
||||||
|
// If not found or found the key itself, then search again in default section.
|
||||||
|
nk, err := k.s.GetKey(noption)
|
||||||
|
if err != nil || k == nk {
|
||||||
|
nk, _ = k.s.f.Section("").GetKey(noption)
|
||||||
|
if nk == nil {
|
||||||
|
// Stop when no results found in the default section,
|
||||||
|
// and returns the value as-is.
|
||||||
|
break
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// Substitute by new value and take off leading '%(' and trailing ')s'.
|
||||||
|
val = strings.Replace(val, vr, nk.value, -1)
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// String returns string representation of value.
|
||||||
|
func (k *Key) String() string {
|
||||||
|
return k.transformValue(k.value)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Validate accepts a validate function which can
|
||||||
|
// return modifed result as key value.
|
||||||
|
func (k *Key) Validate(fn func(string) string) string {
|
||||||
|
return fn(k.String())
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseBool returns the boolean value represented by the string.
|
||||||
|
//
|
||||||
|
// It accepts 1, t, T, TRUE, true, True, YES, yes, Yes, y, ON, on, On,
|
||||||
|
// 0, f, F, FALSE, false, False, NO, no, No, n, OFF, off, Off.
|
||||||
|
// Any other value returns an error.
|
||||||
|
func parseBool(str string) (value bool, err error) {
|
||||||
|
switch str {
|
||||||
|
case "1", "t", "T", "true", "TRUE", "True", "YES", "yes", "Yes", "y", "ON", "on", "On":
|
||||||
|
return true, nil
|
||||||
|
case "0", "f", "F", "false", "FALSE", "False", "NO", "no", "No", "n", "OFF", "off", "Off":
|
||||||
|
return false, nil
|
||||||
|
}
|
||||||
|
return false, fmt.Errorf("parsing \"%s\": invalid syntax", str)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Bool returns bool type value.
|
||||||
|
func (k *Key) Bool() (bool, error) {
|
||||||
|
return parseBool(k.String())
|
||||||
|
}
|
||||||
|
|
||||||
|
// Float64 returns float64 type value.
|
||||||
|
func (k *Key) Float64() (float64, error) {
|
||||||
|
return strconv.ParseFloat(k.String(), 64)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Int returns int type value.
|
||||||
|
func (k *Key) Int() (int, error) {
|
||||||
|
v, err := strconv.ParseInt(k.String(), 0, 64)
|
||||||
|
return int(v), err
|
||||||
|
}
|
||||||
|
|
||||||
|
// Int64 returns int64 type value.
|
||||||
|
func (k *Key) Int64() (int64, error) {
|
||||||
|
return strconv.ParseInt(k.String(), 0, 64)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Uint returns uint type valued.
|
||||||
|
func (k *Key) Uint() (uint, error) {
|
||||||
|
u, e := strconv.ParseUint(k.String(), 0, 64)
|
||||||
|
return uint(u), e
|
||||||
|
}
|
||||||
|
|
||||||
|
// Uint64 returns uint64 type value.
|
||||||
|
func (k *Key) Uint64() (uint64, error) {
|
||||||
|
return strconv.ParseUint(k.String(), 0, 64)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Duration returns time.Duration type value.
|
||||||
|
func (k *Key) Duration() (time.Duration, error) {
|
||||||
|
return time.ParseDuration(k.String())
|
||||||
|
}
|
||||||
|
|
||||||
|
// TimeFormat parses with given format and returns time.Time type value.
|
||||||
|
func (k *Key) TimeFormat(format string) (time.Time, error) {
|
||||||
|
return time.Parse(format, k.String())
|
||||||
|
}
|
||||||
|
|
||||||
|
// Time parses with RFC3339 format and returns time.Time type value.
|
||||||
|
func (k *Key) Time() (time.Time, error) {
|
||||||
|
return k.TimeFormat(time.RFC3339)
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustString returns default value if key value is empty.
|
||||||
|
func (k *Key) MustString(defaultVal string) string {
|
||||||
|
val := k.String()
|
||||||
|
if len(val) == 0 {
|
||||||
|
k.value = defaultVal
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustBool always returns value without error,
|
||||||
|
// it returns false if error occurs.
|
||||||
|
func (k *Key) MustBool(defaultVal ...bool) bool {
|
||||||
|
val, err := k.Bool()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatBool(defaultVal[0])
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustFloat64 always returns value without error,
|
||||||
|
// it returns 0.0 if error occurs.
|
||||||
|
func (k *Key) MustFloat64(defaultVal ...float64) float64 {
|
||||||
|
val, err := k.Float64()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatFloat(defaultVal[0], 'f', -1, 64)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustInt always returns value without error,
|
||||||
|
// it returns 0 if error occurs.
|
||||||
|
func (k *Key) MustInt(defaultVal ...int) int {
|
||||||
|
val, err := k.Int()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatInt(int64(defaultVal[0]), 10)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustInt64 always returns value without error,
|
||||||
|
// it returns 0 if error occurs.
|
||||||
|
func (k *Key) MustInt64(defaultVal ...int64) int64 {
|
||||||
|
val, err := k.Int64()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatInt(defaultVal[0], 10)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustUint always returns value without error,
|
||||||
|
// it returns 0 if error occurs.
|
||||||
|
func (k *Key) MustUint(defaultVal ...uint) uint {
|
||||||
|
val, err := k.Uint()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatUint(uint64(defaultVal[0]), 10)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustUint64 always returns value without error,
|
||||||
|
// it returns 0 if error occurs.
|
||||||
|
func (k *Key) MustUint64(defaultVal ...uint64) uint64 {
|
||||||
|
val, err := k.Uint64()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = strconv.FormatUint(defaultVal[0], 10)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustDuration always returns value without error,
|
||||||
|
// it returns zero value if error occurs.
|
||||||
|
func (k *Key) MustDuration(defaultVal ...time.Duration) time.Duration {
|
||||||
|
val, err := k.Duration()
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = defaultVal[0].String()
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustTimeFormat always parses with given format and returns value without error,
|
||||||
|
// it returns zero value if error occurs.
|
||||||
|
func (k *Key) MustTimeFormat(format string, defaultVal ...time.Time) time.Time {
|
||||||
|
val, err := k.TimeFormat(format)
|
||||||
|
if len(defaultVal) > 0 && err != nil {
|
||||||
|
k.value = defaultVal[0].Format(format)
|
||||||
|
return defaultVal[0]
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// MustTime always parses with RFC3339 format and returns value without error,
|
||||||
|
// it returns zero value if error occurs.
|
||||||
|
func (k *Key) MustTime(defaultVal ...time.Time) time.Time {
|
||||||
|
return k.MustTimeFormat(time.RFC3339, defaultVal...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// In always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) In(defaultVal string, candidates []string) string {
|
||||||
|
val := k.String()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InFloat64 always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InFloat64(defaultVal float64, candidates []float64) float64 {
|
||||||
|
val := k.MustFloat64()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InInt always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InInt(defaultVal int, candidates []int) int {
|
||||||
|
val := k.MustInt()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InInt64 always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InInt64(defaultVal int64, candidates []int64) int64 {
|
||||||
|
val := k.MustInt64()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InUint always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InUint(defaultVal uint, candidates []uint) uint {
|
||||||
|
val := k.MustUint()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InUint64 always returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InUint64(defaultVal uint64, candidates []uint64) uint64 {
|
||||||
|
val := k.MustUint64()
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InTimeFormat always parses with given format and returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InTimeFormat(format string, defaultVal time.Time, candidates []time.Time) time.Time {
|
||||||
|
val := k.MustTimeFormat(format)
|
||||||
|
for _, cand := range candidates {
|
||||||
|
if val == cand {
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
|
||||||
|
// InTime always parses with RFC3339 format and returns value without error,
|
||||||
|
// it returns default value if error occurs or doesn't fit into candidates.
|
||||||
|
func (k *Key) InTime(defaultVal time.Time, candidates []time.Time) time.Time {
|
||||||
|
return k.InTimeFormat(time.RFC3339, defaultVal, candidates)
|
||||||
|
}
|
||||||
|
|
||||||
|
// RangeFloat64 checks if value is in given range inclusively,
|
||||||
|
// and returns default value if it's not.
|
||||||
|
func (k *Key) RangeFloat64(defaultVal, min, max float64) float64 {
|
||||||
|
val := k.MustFloat64()
|
||||||
|
if val < min || val > max {
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// RangeInt checks if value is in given range inclusively,
|
||||||
|
// and returns default value if it's not.
|
||||||
|
func (k *Key) RangeInt(defaultVal, min, max int) int {
|
||||||
|
val := k.MustInt()
|
||||||
|
if val < min || val > max {
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// RangeInt64 checks if value is in given range inclusively,
|
||||||
|
// and returns default value if it's not.
|
||||||
|
func (k *Key) RangeInt64(defaultVal, min, max int64) int64 {
|
||||||
|
val := k.MustInt64()
|
||||||
|
if val < min || val > max {
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// RangeTimeFormat checks if value with given format is in given range inclusively,
|
||||||
|
// and returns default value if it's not.
|
||||||
|
func (k *Key) RangeTimeFormat(format string, defaultVal, min, max time.Time) time.Time {
|
||||||
|
val := k.MustTimeFormat(format)
|
||||||
|
if val.Unix() < min.Unix() || val.Unix() > max.Unix() {
|
||||||
|
return defaultVal
|
||||||
|
}
|
||||||
|
return val
|
||||||
|
}
|
||||||
|
|
||||||
|
// RangeTime checks if value with RFC3339 format is in given range inclusively,
|
||||||
|
// and returns default value if it's not.
|
||||||
|
func (k *Key) RangeTime(defaultVal, min, max time.Time) time.Time {
|
||||||
|
return k.RangeTimeFormat(time.RFC3339, defaultVal, min, max)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Strings returns list of string divided by given delimiter.
|
||||||
|
func (k *Key) Strings(delim string) []string {
|
||||||
|
str := k.String()
|
||||||
|
if len(str) == 0 {
|
||||||
|
return []string{}
|
||||||
|
}
|
||||||
|
|
||||||
|
runes := []rune(str)
|
||||||
|
vals := make([]string, 0, 2)
|
||||||
|
var buf bytes.Buffer
|
||||||
|
escape := false
|
||||||
|
idx := 0
|
||||||
|
for {
|
||||||
|
if escape {
|
||||||
|
escape = false
|
||||||
|
if runes[idx] != '\\' && !strings.HasPrefix(string(runes[idx:]), delim) {
|
||||||
|
buf.WriteRune('\\')
|
||||||
|
}
|
||||||
|
buf.WriteRune(runes[idx])
|
||||||
|
} else {
|
||||||
|
if runes[idx] == '\\' {
|
||||||
|
escape = true
|
||||||
|
} else if strings.HasPrefix(string(runes[idx:]), delim) {
|
||||||
|
idx += len(delim) - 1
|
||||||
|
vals = append(vals, strings.TrimSpace(buf.String()))
|
||||||
|
buf.Reset()
|
||||||
|
} else {
|
||||||
|
buf.WriteRune(runes[idx])
|
||||||
|
}
|
||||||
|
}
|
||||||
|
idx++
|
||||||
|
if idx == len(runes) {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
if buf.Len() > 0 {
|
||||||
|
vals = append(vals, strings.TrimSpace(buf.String()))
|
||||||
|
}
|
||||||
|
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// StringsWithShadows returns list of string divided by given delimiter.
|
||||||
|
// Shadows will also be appended if any.
|
||||||
|
func (k *Key) StringsWithShadows(delim string) []string {
|
||||||
|
vals := k.ValueWithShadows()
|
||||||
|
results := make([]string, 0, len(vals)*2)
|
||||||
|
for i := range vals {
|
||||||
|
if len(vals) == 0 {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
results = append(results, strings.Split(vals[i], delim)...)
|
||||||
|
}
|
||||||
|
|
||||||
|
for i := range results {
|
||||||
|
results[i] = k.transformValue(strings.TrimSpace(results[i]))
|
||||||
|
}
|
||||||
|
return results
|
||||||
|
}
|
||||||
|
|
||||||
|
// Float64s returns list of float64 divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Float64s(delim string) []float64 {
|
||||||
|
vals, _ := k.parseFloat64s(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Ints returns list of int divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Ints(delim string) []int {
|
||||||
|
vals, _ := k.parseInts(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Int64s returns list of int64 divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Int64s(delim string) []int64 {
|
||||||
|
vals, _ := k.parseInt64s(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Uints returns list of uint divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Uints(delim string) []uint {
|
||||||
|
vals, _ := k.parseUints(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Uint64s returns list of uint64 divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Uint64s(delim string) []uint64 {
|
||||||
|
vals, _ := k.parseUint64s(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Bools returns list of bool divided by given delimiter. Any invalid input will be treated as zero value.
|
||||||
|
func (k *Key) Bools(delim string) []bool {
|
||||||
|
vals, _ := k.parseBools(k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// TimesFormat parses with given format and returns list of time.Time divided by given delimiter.
|
||||||
|
// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC).
|
||||||
|
func (k *Key) TimesFormat(format, delim string) []time.Time {
|
||||||
|
vals, _ := k.parseTimesFormat(format, k.Strings(delim), true, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// Times parses with RFC3339 format and returns list of time.Time divided by given delimiter.
|
||||||
|
// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC).
|
||||||
|
func (k *Key) Times(delim string) []time.Time {
|
||||||
|
return k.TimesFormat(time.RFC3339, delim)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidFloat64s returns list of float64 divided by given delimiter. If some value is not float, then
|
||||||
|
// it will not be included to result list.
|
||||||
|
func (k *Key) ValidFloat64s(delim string) []float64 {
|
||||||
|
vals, _ := k.parseFloat64s(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidInts returns list of int divided by given delimiter. If some value is not integer, then it will
|
||||||
|
// not be included to result list.
|
||||||
|
func (k *Key) ValidInts(delim string) []int {
|
||||||
|
vals, _ := k.parseInts(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidInt64s returns list of int64 divided by given delimiter. If some value is not 64-bit integer,
|
||||||
|
// then it will not be included to result list.
|
||||||
|
func (k *Key) ValidInt64s(delim string) []int64 {
|
||||||
|
vals, _ := k.parseInt64s(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidUints returns list of uint divided by given delimiter. If some value is not unsigned integer,
|
||||||
|
// then it will not be included to result list.
|
||||||
|
func (k *Key) ValidUints(delim string) []uint {
|
||||||
|
vals, _ := k.parseUints(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidUint64s returns list of uint64 divided by given delimiter. If some value is not 64-bit unsigned
|
||||||
|
// integer, then it will not be included to result list.
|
||||||
|
func (k *Key) ValidUint64s(delim string) []uint64 {
|
||||||
|
vals, _ := k.parseUint64s(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidBools returns list of bool divided by given delimiter. If some value is not 64-bit unsigned
|
||||||
|
// integer, then it will not be included to result list.
|
||||||
|
func (k *Key) ValidBools(delim string) []bool {
|
||||||
|
vals, _ := k.parseBools(k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidTimesFormat parses with given format and returns list of time.Time divided by given delimiter.
|
||||||
|
func (k *Key) ValidTimesFormat(format, delim string) []time.Time {
|
||||||
|
vals, _ := k.parseTimesFormat(format, k.Strings(delim), false, false)
|
||||||
|
return vals
|
||||||
|
}
|
||||||
|
|
||||||
|
// ValidTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter.
|
||||||
|
func (k *Key) ValidTimes(delim string) []time.Time {
|
||||||
|
return k.ValidTimesFormat(time.RFC3339, delim)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictFloat64s returns list of float64 divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictFloat64s(delim string) ([]float64, error) {
|
||||||
|
return k.parseFloat64s(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictInts returns list of int divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictInts(delim string) ([]int, error) {
|
||||||
|
return k.parseInts(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictInt64s returns list of int64 divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictInt64s(delim string) ([]int64, error) {
|
||||||
|
return k.parseInt64s(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictUints returns list of uint divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictUints(delim string) ([]uint, error) {
|
||||||
|
return k.parseUints(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictUint64s returns list of uint64 divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictUint64s(delim string) ([]uint64, error) {
|
||||||
|
return k.parseUint64s(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictBools returns list of bool divided by given delimiter or error on first invalid input.
|
||||||
|
func (k *Key) StrictBools(delim string) ([]bool, error) {
|
||||||
|
return k.parseBools(k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictTimesFormat parses with given format and returns list of time.Time divided by given delimiter
|
||||||
|
// or error on first invalid input.
|
||||||
|
func (k *Key) StrictTimesFormat(format, delim string) ([]time.Time, error) {
|
||||||
|
return k.parseTimesFormat(format, k.Strings(delim), false, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter
|
||||||
|
// or error on first invalid input.
|
||||||
|
func (k *Key) StrictTimes(delim string) ([]time.Time, error) {
|
||||||
|
return k.StrictTimesFormat(time.RFC3339, delim)
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseBools transforms strings to bools.
|
||||||
|
func (k *Key) parseBools(strs []string, addInvalid, returnOnInvalid bool) ([]bool, error) {
|
||||||
|
vals := make([]bool, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := parseBool(str)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, val.(bool))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseFloat64s transforms strings to float64s.
|
||||||
|
func (k *Key) parseFloat64s(strs []string, addInvalid, returnOnInvalid bool) ([]float64, error) {
|
||||||
|
vals := make([]float64, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := strconv.ParseFloat(str, 64)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, val.(float64))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseInts transforms strings to ints.
|
||||||
|
func (k *Key) parseInts(strs []string, addInvalid, returnOnInvalid bool) ([]int, error) {
|
||||||
|
vals := make([]int, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := strconv.ParseInt(str, 0, 64)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, int(val.(int64)))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseInt64s transforms strings to int64s.
|
||||||
|
func (k *Key) parseInt64s(strs []string, addInvalid, returnOnInvalid bool) ([]int64, error) {
|
||||||
|
vals := make([]int64, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := strconv.ParseInt(str, 0, 64)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, val.(int64))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseUints transforms strings to uints.
|
||||||
|
func (k *Key) parseUints(strs []string, addInvalid, returnOnInvalid bool) ([]uint, error) {
|
||||||
|
vals := make([]uint, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := strconv.ParseUint(str, 0, 64)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, uint(val.(uint64)))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// parseUint64s transforms strings to uint64s.
|
||||||
|
func (k *Key) parseUint64s(strs []string, addInvalid, returnOnInvalid bool) ([]uint64, error) {
|
||||||
|
vals := make([]uint64, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := strconv.ParseUint(str, 0, 64)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, val.(uint64))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
type Parser func(str string) (interface{}, error)
|
||||||
|
|
||||||
|
// parseTimesFormat transforms strings to times in given format.
|
||||||
|
func (k *Key) parseTimesFormat(format string, strs []string, addInvalid, returnOnInvalid bool) ([]time.Time, error) {
|
||||||
|
vals := make([]time.Time, 0, len(strs))
|
||||||
|
parser := func(str string) (interface{}, error) {
|
||||||
|
val, err := time.Parse(format, str)
|
||||||
|
return val, err
|
||||||
|
}
|
||||||
|
rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
|
||||||
|
if err == nil {
|
||||||
|
for _, val := range rawVals {
|
||||||
|
vals = append(vals, val.(time.Time))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, err
|
||||||
|
}
|
||||||
|
|
||||||
|
// doParse transforms strings to different types
|
||||||
|
func (k *Key) doParse(strs []string, addInvalid, returnOnInvalid bool, parser Parser) ([]interface{}, error) {
|
||||||
|
vals := make([]interface{}, 0, len(strs))
|
||||||
|
for _, str := range strs {
|
||||||
|
val, err := parser(str)
|
||||||
|
if err != nil && returnOnInvalid {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
if err == nil || addInvalid {
|
||||||
|
vals = append(vals, val)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return vals, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// SetValue changes key value.
|
||||||
|
func (k *Key) SetValue(v string) {
|
||||||
|
if k.s.f.BlockMode {
|
||||||
|
k.s.f.lock.Lock()
|
||||||
|
defer k.s.f.lock.Unlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
k.value = v
|
||||||
|
k.s.keysHash[k.name] = v
|
||||||
|
}
|
|
@ -0,0 +1,520 @@
|
||||||
|
// Copyright 2015 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"bufio"
|
||||||
|
"bytes"
|
||||||
|
"fmt"
|
||||||
|
"io"
|
||||||
|
"regexp"
|
||||||
|
"strconv"
|
||||||
|
"strings"
|
||||||
|
"unicode"
|
||||||
|
)
|
||||||
|
|
||||||
|
const minReaderBufferSize = 4096
|
||||||
|
|
||||||
|
var pythonMultiline = regexp.MustCompile(`^([\t\f ]+)(.*)`)
|
||||||
|
|
||||||
|
type parserOptions struct {
|
||||||
|
IgnoreContinuation bool
|
||||||
|
IgnoreInlineComment bool
|
||||||
|
AllowPythonMultilineValues bool
|
||||||
|
SpaceBeforeInlineComment bool
|
||||||
|
UnescapeValueDoubleQuotes bool
|
||||||
|
UnescapeValueCommentSymbols bool
|
||||||
|
PreserveSurroundedQuote bool
|
||||||
|
DebugFunc DebugFunc
|
||||||
|
ReaderBufferSize int
|
||||||
|
}
|
||||||
|
|
||||||
|
type parser struct {
|
||||||
|
buf *bufio.Reader
|
||||||
|
options parserOptions
|
||||||
|
|
||||||
|
isEOF bool
|
||||||
|
count int
|
||||||
|
comment *bytes.Buffer
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) debug(format string, args ...interface{}) {
|
||||||
|
if p.options.DebugFunc != nil {
|
||||||
|
p.options.DebugFunc(fmt.Sprintf(format, args...))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
func newParser(r io.Reader, opts parserOptions) *parser {
|
||||||
|
size := opts.ReaderBufferSize
|
||||||
|
if size < minReaderBufferSize {
|
||||||
|
size = minReaderBufferSize
|
||||||
|
}
|
||||||
|
|
||||||
|
return &parser{
|
||||||
|
buf: bufio.NewReaderSize(r, size),
|
||||||
|
options: opts,
|
||||||
|
count: 1,
|
||||||
|
comment: &bytes.Buffer{},
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// BOM handles header of UTF-8, UTF-16 LE and UTF-16 BE's BOM format.
|
||||||
|
// http://en.wikipedia.org/wiki/Byte_order_mark#Representations_of_byte_order_marks_by_encoding
|
||||||
|
func (p *parser) BOM() error {
|
||||||
|
mask, err := p.buf.Peek(2)
|
||||||
|
if err != nil && err != io.EOF {
|
||||||
|
return err
|
||||||
|
} else if len(mask) < 2 {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
switch {
|
||||||
|
case mask[0] == 254 && mask[1] == 255:
|
||||||
|
fallthrough
|
||||||
|
case mask[0] == 255 && mask[1] == 254:
|
||||||
|
_, err = p.buf.Read(mask)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
case mask[0] == 239 && mask[1] == 187:
|
||||||
|
mask, err := p.buf.Peek(3)
|
||||||
|
if err != nil && err != io.EOF {
|
||||||
|
return err
|
||||||
|
} else if len(mask) < 3 {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
if mask[2] == 191 {
|
||||||
|
_, err = p.buf.Read(mask)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) readUntil(delim byte) ([]byte, error) {
|
||||||
|
data, err := p.buf.ReadBytes(delim)
|
||||||
|
if err != nil {
|
||||||
|
if err == io.EOF {
|
||||||
|
p.isEOF = true
|
||||||
|
} else {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return data, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func cleanComment(in []byte) ([]byte, bool) {
|
||||||
|
i := bytes.IndexAny(in, "#;")
|
||||||
|
if i == -1 {
|
||||||
|
return nil, false
|
||||||
|
}
|
||||||
|
return in[i:], true
|
||||||
|
}
|
||||||
|
|
||||||
|
func readKeyName(delimiters string, in []byte) (string, int, error) {
|
||||||
|
line := string(in)
|
||||||
|
|
||||||
|
// Check if key name surrounded by quotes.
|
||||||
|
var keyQuote string
|
||||||
|
if line[0] == '"' {
|
||||||
|
if len(line) > 6 && line[0:3] == `"""` {
|
||||||
|
keyQuote = `"""`
|
||||||
|
} else {
|
||||||
|
keyQuote = `"`
|
||||||
|
}
|
||||||
|
} else if line[0] == '`' {
|
||||||
|
keyQuote = "`"
|
||||||
|
}
|
||||||
|
|
||||||
|
// Get out key name
|
||||||
|
var endIdx int
|
||||||
|
if len(keyQuote) > 0 {
|
||||||
|
startIdx := len(keyQuote)
|
||||||
|
// FIXME: fail case -> """"""name"""=value
|
||||||
|
pos := strings.Index(line[startIdx:], keyQuote)
|
||||||
|
if pos == -1 {
|
||||||
|
return "", -1, fmt.Errorf("missing closing key quote: %s", line)
|
||||||
|
}
|
||||||
|
pos += startIdx
|
||||||
|
|
||||||
|
// Find key-value delimiter
|
||||||
|
i := strings.IndexAny(line[pos+startIdx:], delimiters)
|
||||||
|
if i < 0 {
|
||||||
|
return "", -1, ErrDelimiterNotFound{line}
|
||||||
|
}
|
||||||
|
endIdx = pos + i
|
||||||
|
return strings.TrimSpace(line[startIdx:pos]), endIdx + startIdx + 1, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
endIdx = strings.IndexAny(line, delimiters)
|
||||||
|
if endIdx < 0 {
|
||||||
|
return "", -1, ErrDelimiterNotFound{line}
|
||||||
|
}
|
||||||
|
if endIdx == 0 {
|
||||||
|
return "", -1, ErrEmptyKeyName{line}
|
||||||
|
}
|
||||||
|
|
||||||
|
return strings.TrimSpace(line[0:endIdx]), endIdx + 1, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) readMultilines(line, val, valQuote string) (string, error) {
|
||||||
|
for {
|
||||||
|
data, err := p.readUntil('\n')
|
||||||
|
if err != nil {
|
||||||
|
return "", err
|
||||||
|
}
|
||||||
|
next := string(data)
|
||||||
|
|
||||||
|
pos := strings.LastIndex(next, valQuote)
|
||||||
|
if pos > -1 {
|
||||||
|
val += next[:pos]
|
||||||
|
|
||||||
|
comment, has := cleanComment([]byte(next[pos:]))
|
||||||
|
if has {
|
||||||
|
p.comment.Write(bytes.TrimSpace(comment))
|
||||||
|
}
|
||||||
|
break
|
||||||
|
}
|
||||||
|
val += next
|
||||||
|
if p.isEOF {
|
||||||
|
return "", fmt.Errorf("missing closing key quote from %q to %q", line, next)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return val, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) readContinuationLines(val string) (string, error) {
|
||||||
|
for {
|
||||||
|
data, err := p.readUntil('\n')
|
||||||
|
if err != nil {
|
||||||
|
return "", err
|
||||||
|
}
|
||||||
|
next := strings.TrimSpace(string(data))
|
||||||
|
|
||||||
|
if len(next) == 0 {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
val += next
|
||||||
|
if val[len(val)-1] != '\\' {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
val = val[:len(val)-1]
|
||||||
|
}
|
||||||
|
return val, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// hasSurroundedQuote check if and only if the first and last characters
|
||||||
|
// are quotes \" or \'.
|
||||||
|
// It returns false if any other parts also contain same kind of quotes.
|
||||||
|
func hasSurroundedQuote(in string, quote byte) bool {
|
||||||
|
return len(in) >= 2 && in[0] == quote && in[len(in)-1] == quote &&
|
||||||
|
strings.IndexByte(in[1:], quote) == len(in)-2
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) readValue(in []byte, bufferSize int) (string, error) {
|
||||||
|
|
||||||
|
line := strings.TrimLeftFunc(string(in), unicode.IsSpace)
|
||||||
|
if len(line) == 0 {
|
||||||
|
if p.options.AllowPythonMultilineValues && len(in) > 0 && in[len(in)-1] == '\n' {
|
||||||
|
return p.readPythonMultilines(line, bufferSize)
|
||||||
|
}
|
||||||
|
return "", nil
|
||||||
|
}
|
||||||
|
|
||||||
|
var valQuote string
|
||||||
|
if len(line) > 3 && line[0:3] == `"""` {
|
||||||
|
valQuote = `"""`
|
||||||
|
} else if line[0] == '`' {
|
||||||
|
valQuote = "`"
|
||||||
|
} else if p.options.UnescapeValueDoubleQuotes && line[0] == '"' {
|
||||||
|
valQuote = `"`
|
||||||
|
}
|
||||||
|
|
||||||
|
if len(valQuote) > 0 {
|
||||||
|
startIdx := len(valQuote)
|
||||||
|
pos := strings.LastIndex(line[startIdx:], valQuote)
|
||||||
|
// Check for multi-line value
|
||||||
|
if pos == -1 {
|
||||||
|
return p.readMultilines(line, line[startIdx:], valQuote)
|
||||||
|
}
|
||||||
|
|
||||||
|
if p.options.UnescapeValueDoubleQuotes && valQuote == `"` {
|
||||||
|
return strings.Replace(line[startIdx:pos+startIdx], `\"`, `"`, -1), nil
|
||||||
|
}
|
||||||
|
return line[startIdx : pos+startIdx], nil
|
||||||
|
}
|
||||||
|
|
||||||
|
lastChar := line[len(line)-1]
|
||||||
|
// Won't be able to reach here if value only contains whitespace
|
||||||
|
line = strings.TrimSpace(line)
|
||||||
|
trimmedLastChar := line[len(line)-1]
|
||||||
|
|
||||||
|
// Check continuation lines when desired
|
||||||
|
if !p.options.IgnoreContinuation && trimmedLastChar == '\\' {
|
||||||
|
return p.readContinuationLines(line[:len(line)-1])
|
||||||
|
}
|
||||||
|
|
||||||
|
// Check if ignore inline comment
|
||||||
|
if !p.options.IgnoreInlineComment {
|
||||||
|
var i int
|
||||||
|
if p.options.SpaceBeforeInlineComment {
|
||||||
|
i = strings.Index(line, " #")
|
||||||
|
if i == -1 {
|
||||||
|
i = strings.Index(line, " ;")
|
||||||
|
}
|
||||||
|
|
||||||
|
} else {
|
||||||
|
i = strings.IndexAny(line, "#;")
|
||||||
|
}
|
||||||
|
|
||||||
|
if i > -1 {
|
||||||
|
p.comment.WriteString(line[i:])
|
||||||
|
line = strings.TrimSpace(line[:i])
|
||||||
|
}
|
||||||
|
|
||||||
|
}
|
||||||
|
|
||||||
|
// Trim single and double quotes
|
||||||
|
if (hasSurroundedQuote(line, '\'') ||
|
||||||
|
hasSurroundedQuote(line, '"')) && !p.options.PreserveSurroundedQuote {
|
||||||
|
line = line[1 : len(line)-1]
|
||||||
|
} else if len(valQuote) == 0 && p.options.UnescapeValueCommentSymbols {
|
||||||
|
line = strings.ReplaceAll(line, `\;`, ";")
|
||||||
|
line = strings.ReplaceAll(line, `\#`, "#")
|
||||||
|
} else if p.options.AllowPythonMultilineValues && lastChar == '\n' {
|
||||||
|
return p.readPythonMultilines(line, bufferSize)
|
||||||
|
}
|
||||||
|
|
||||||
|
return line, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func (p *parser) readPythonMultilines(line string, bufferSize int) (string, error) {
|
||||||
|
parserBufferPeekResult, _ := p.buf.Peek(bufferSize)
|
||||||
|
peekBuffer := bytes.NewBuffer(parserBufferPeekResult)
|
||||||
|
|
||||||
|
for {
|
||||||
|
peekData, peekErr := peekBuffer.ReadBytes('\n')
|
||||||
|
if peekErr != nil && peekErr != io.EOF {
|
||||||
|
p.debug("readPythonMultilines: failed to peek with error: %v", peekErr)
|
||||||
|
return "", peekErr
|
||||||
|
}
|
||||||
|
|
||||||
|
p.debug("readPythonMultilines: parsing %q", string(peekData))
|
||||||
|
|
||||||
|
peekMatches := pythonMultiline.FindStringSubmatch(string(peekData))
|
||||||
|
p.debug("readPythonMultilines: matched %d parts", len(peekMatches))
|
||||||
|
for n, v := range peekMatches {
|
||||||
|
p.debug(" %d: %q", n, v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Return if not a Python multiline value.
|
||||||
|
if len(peekMatches) != 3 {
|
||||||
|
p.debug("readPythonMultilines: end of value, got: %q", line)
|
||||||
|
return line, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Advance the parser reader (buffer) in-sync with the peek buffer.
|
||||||
|
_, err := p.buf.Discard(len(peekData))
|
||||||
|
if err != nil {
|
||||||
|
p.debug("readPythonMultilines: failed to skip to the end, returning error")
|
||||||
|
return "", err
|
||||||
|
}
|
||||||
|
|
||||||
|
line += "\n" + peekMatches[0]
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// parse parses data through an io.Reader.
|
||||||
|
func (f *File) parse(reader io.Reader) (err error) {
|
||||||
|
p := newParser(reader, parserOptions{
|
||||||
|
IgnoreContinuation: f.options.IgnoreContinuation,
|
||||||
|
IgnoreInlineComment: f.options.IgnoreInlineComment,
|
||||||
|
AllowPythonMultilineValues: f.options.AllowPythonMultilineValues,
|
||||||
|
SpaceBeforeInlineComment: f.options.SpaceBeforeInlineComment,
|
||||||
|
UnescapeValueDoubleQuotes: f.options.UnescapeValueDoubleQuotes,
|
||||||
|
UnescapeValueCommentSymbols: f.options.UnescapeValueCommentSymbols,
|
||||||
|
PreserveSurroundedQuote: f.options.PreserveSurroundedQuote,
|
||||||
|
DebugFunc: f.options.DebugFunc,
|
||||||
|
ReaderBufferSize: f.options.ReaderBufferSize,
|
||||||
|
})
|
||||||
|
if err = p.BOM(); err != nil {
|
||||||
|
return fmt.Errorf("BOM: %v", err)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Ignore error because default section name is never empty string.
|
||||||
|
name := DefaultSection
|
||||||
|
if f.options.Insensitive || f.options.InsensitiveSections {
|
||||||
|
name = strings.ToLower(DefaultSection)
|
||||||
|
}
|
||||||
|
section, _ := f.NewSection(name)
|
||||||
|
|
||||||
|
// This "last" is not strictly equivalent to "previous one" if current key is not the first nested key
|
||||||
|
var isLastValueEmpty bool
|
||||||
|
var lastRegularKey *Key
|
||||||
|
|
||||||
|
var line []byte
|
||||||
|
var inUnparseableSection bool
|
||||||
|
|
||||||
|
// NOTE: Iterate and increase `currentPeekSize` until
|
||||||
|
// the size of the parser buffer is found.
|
||||||
|
// TODO(unknwon): When Golang 1.10 is the lowest version supported, replace with `parserBufferSize := p.buf.Size()`.
|
||||||
|
parserBufferSize := 0
|
||||||
|
// NOTE: Peek 4kb at a time.
|
||||||
|
currentPeekSize := minReaderBufferSize
|
||||||
|
|
||||||
|
if f.options.AllowPythonMultilineValues {
|
||||||
|
for {
|
||||||
|
peekBytes, _ := p.buf.Peek(currentPeekSize)
|
||||||
|
peekBytesLength := len(peekBytes)
|
||||||
|
|
||||||
|
if parserBufferSize >= peekBytesLength {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
|
||||||
|
currentPeekSize *= 2
|
||||||
|
parserBufferSize = peekBytesLength
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
for !p.isEOF {
|
||||||
|
line, err = p.readUntil('\n')
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
if f.options.AllowNestedValues &&
|
||||||
|
isLastValueEmpty && len(line) > 0 {
|
||||||
|
if line[0] == ' ' || line[0] == '\t' {
|
||||||
|
err = lastRegularKey.addNestedValue(string(bytes.TrimSpace(line)))
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
line = bytes.TrimLeftFunc(line, unicode.IsSpace)
|
||||||
|
if len(line) == 0 {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
// Comments
|
||||||
|
if line[0] == '#' || line[0] == ';' {
|
||||||
|
// Note: we do not care ending line break,
|
||||||
|
// it is needed for adding second line,
|
||||||
|
// so just clean it once at the end when set to value.
|
||||||
|
p.comment.Write(line)
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
// Section
|
||||||
|
if line[0] == '[' {
|
||||||
|
// Read to the next ']' (TODO: support quoted strings)
|
||||||
|
closeIdx := bytes.LastIndexByte(line, ']')
|
||||||
|
if closeIdx == -1 {
|
||||||
|
return fmt.Errorf("unclosed section: %s", line)
|
||||||
|
}
|
||||||
|
|
||||||
|
name := string(line[1:closeIdx])
|
||||||
|
section, err = f.NewSection(name)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
comment, has := cleanComment(line[closeIdx+1:])
|
||||||
|
if has {
|
||||||
|
p.comment.Write(comment)
|
||||||
|
}
|
||||||
|
|
||||||
|
section.Comment = strings.TrimSpace(p.comment.String())
|
||||||
|
|
||||||
|
// Reset auto-counter and comments
|
||||||
|
p.comment.Reset()
|
||||||
|
p.count = 1
|
||||||
|
// Nested values can't span sections
|
||||||
|
isLastValueEmpty = false
|
||||||
|
|
||||||
|
inUnparseableSection = false
|
||||||
|
for i := range f.options.UnparseableSections {
|
||||||
|
if f.options.UnparseableSections[i] == name ||
|
||||||
|
((f.options.Insensitive || f.options.InsensitiveSections) && strings.EqualFold(f.options.UnparseableSections[i], name)) {
|
||||||
|
inUnparseableSection = true
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if inUnparseableSection {
|
||||||
|
section.isRawSection = true
|
||||||
|
section.rawBody += string(line)
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
kname, offset, err := readKeyName(f.options.KeyValueDelimiters, line)
|
||||||
|
if err != nil {
|
||||||
|
switch {
|
||||||
|
// Treat as boolean key when desired, and whole line is key name.
|
||||||
|
case IsErrDelimiterNotFound(err):
|
||||||
|
switch {
|
||||||
|
case f.options.AllowBooleanKeys:
|
||||||
|
kname, err := p.readValue(line, parserBufferSize)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
key, err := section.NewBooleanKey(kname)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
key.Comment = strings.TrimSpace(p.comment.String())
|
||||||
|
p.comment.Reset()
|
||||||
|
continue
|
||||||
|
|
||||||
|
case f.options.SkipUnrecognizableLines:
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
case IsErrEmptyKeyName(err) && f.options.SkipUnrecognizableLines:
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
// Auto increment.
|
||||||
|
isAutoIncr := false
|
||||||
|
if kname == "-" {
|
||||||
|
isAutoIncr = true
|
||||||
|
kname = "#" + strconv.Itoa(p.count)
|
||||||
|
p.count++
|
||||||
|
}
|
||||||
|
|
||||||
|
value, err := p.readValue(line[offset:], parserBufferSize)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
isLastValueEmpty = len(value) == 0
|
||||||
|
|
||||||
|
key, err := section.NewKey(kname, value)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
key.isAutoIncrement = isAutoIncr
|
||||||
|
key.Comment = strings.TrimSpace(p.comment.String())
|
||||||
|
p.comment.Reset()
|
||||||
|
lastRegularKey = key
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
|
@ -0,0 +1,256 @@
|
||||||
|
// Copyright 2014 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"errors"
|
||||||
|
"fmt"
|
||||||
|
"strings"
|
||||||
|
)
|
||||||
|
|
||||||
|
// Section represents a config section.
|
||||||
|
type Section struct {
|
||||||
|
f *File
|
||||||
|
Comment string
|
||||||
|
name string
|
||||||
|
keys map[string]*Key
|
||||||
|
keyList []string
|
||||||
|
keysHash map[string]string
|
||||||
|
|
||||||
|
isRawSection bool
|
||||||
|
rawBody string
|
||||||
|
}
|
||||||
|
|
||||||
|
func newSection(f *File, name string) *Section {
|
||||||
|
return &Section{
|
||||||
|
f: f,
|
||||||
|
name: name,
|
||||||
|
keys: make(map[string]*Key),
|
||||||
|
keyList: make([]string, 0, 10),
|
||||||
|
keysHash: make(map[string]string),
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// Name returns name of Section.
|
||||||
|
func (s *Section) Name() string {
|
||||||
|
return s.name
|
||||||
|
}
|
||||||
|
|
||||||
|
// Body returns rawBody of Section if the section was marked as unparseable.
|
||||||
|
// It still follows the other rules of the INI format surrounding leading/trailing whitespace.
|
||||||
|
func (s *Section) Body() string {
|
||||||
|
return strings.TrimSpace(s.rawBody)
|
||||||
|
}
|
||||||
|
|
||||||
|
// SetBody updates body content only if section is raw.
|
||||||
|
func (s *Section) SetBody(body string) {
|
||||||
|
if !s.isRawSection {
|
||||||
|
return
|
||||||
|
}
|
||||||
|
s.rawBody = body
|
||||||
|
}
|
||||||
|
|
||||||
|
// NewKey creates a new key to given section.
|
||||||
|
func (s *Section) NewKey(name, val string) (*Key, error) {
|
||||||
|
if len(name) == 0 {
|
||||||
|
return nil, errors.New("error creating new key: empty key name")
|
||||||
|
} else if s.f.options.Insensitive || s.f.options.InsensitiveKeys {
|
||||||
|
name = strings.ToLower(name)
|
||||||
|
}
|
||||||
|
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.Lock()
|
||||||
|
defer s.f.lock.Unlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
if inSlice(name, s.keyList) {
|
||||||
|
if s.f.options.AllowShadows {
|
||||||
|
if err := s.keys[name].addShadow(val); err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
} else {
|
||||||
|
s.keys[name].value = val
|
||||||
|
s.keysHash[name] = val
|
||||||
|
}
|
||||||
|
return s.keys[name], nil
|
||||||
|
}
|
||||||
|
|
||||||
|
s.keyList = append(s.keyList, name)
|
||||||
|
s.keys[name] = newKey(s, name, val)
|
||||||
|
s.keysHash[name] = val
|
||||||
|
return s.keys[name], nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// NewBooleanKey creates a new boolean type key to given section.
|
||||||
|
func (s *Section) NewBooleanKey(name string) (*Key, error) {
|
||||||
|
key, err := s.NewKey(name, "true")
|
||||||
|
if err != nil {
|
||||||
|
return nil, err
|
||||||
|
}
|
||||||
|
|
||||||
|
key.isBooleanType = true
|
||||||
|
return key, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// GetKey returns key in section by given name.
|
||||||
|
func (s *Section) GetKey(name string) (*Key, error) {
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.RLock()
|
||||||
|
}
|
||||||
|
if s.f.options.Insensitive || s.f.options.InsensitiveKeys {
|
||||||
|
name = strings.ToLower(name)
|
||||||
|
}
|
||||||
|
key := s.keys[name]
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.RUnlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
if key == nil {
|
||||||
|
// Check if it is a child-section.
|
||||||
|
sname := s.name
|
||||||
|
for {
|
||||||
|
if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 {
|
||||||
|
sname = sname[:i]
|
||||||
|
sec, err := s.f.GetSection(sname)
|
||||||
|
if err != nil {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
return sec.GetKey(name)
|
||||||
|
}
|
||||||
|
break
|
||||||
|
}
|
||||||
|
return nil, fmt.Errorf("error when getting key of section %q: key %q not exists", s.name, name)
|
||||||
|
}
|
||||||
|
return key, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// HasKey returns true if section contains a key with given name.
|
||||||
|
func (s *Section) HasKey(name string) bool {
|
||||||
|
key, _ := s.GetKey(name)
|
||||||
|
return key != nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// Deprecated: Use "HasKey" instead.
|
||||||
|
func (s *Section) Haskey(name string) bool {
|
||||||
|
return s.HasKey(name)
|
||||||
|
}
|
||||||
|
|
||||||
|
// HasValue returns true if section contains given raw value.
|
||||||
|
func (s *Section) HasValue(value string) bool {
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.RLock()
|
||||||
|
defer s.f.lock.RUnlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
for _, k := range s.keys {
|
||||||
|
if value == k.value {
|
||||||
|
return true
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return false
|
||||||
|
}
|
||||||
|
|
||||||
|
// Key assumes named Key exists in section and returns a zero-value when not.
|
||||||
|
func (s *Section) Key(name string) *Key {
|
||||||
|
key, err := s.GetKey(name)
|
||||||
|
if err != nil {
|
||||||
|
// It's OK here because the only possible error is empty key name,
|
||||||
|
// but if it's empty, this piece of code won't be executed.
|
||||||
|
key, _ = s.NewKey(name, "")
|
||||||
|
return key
|
||||||
|
}
|
||||||
|
return key
|
||||||
|
}
|
||||||
|
|
||||||
|
// Keys returns list of keys of section.
|
||||||
|
func (s *Section) Keys() []*Key {
|
||||||
|
keys := make([]*Key, len(s.keyList))
|
||||||
|
for i := range s.keyList {
|
||||||
|
keys[i] = s.Key(s.keyList[i])
|
||||||
|
}
|
||||||
|
return keys
|
||||||
|
}
|
||||||
|
|
||||||
|
// ParentKeys returns list of keys of parent section.
|
||||||
|
func (s *Section) ParentKeys() []*Key {
|
||||||
|
var parentKeys []*Key
|
||||||
|
sname := s.name
|
||||||
|
for {
|
||||||
|
if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 {
|
||||||
|
sname = sname[:i]
|
||||||
|
sec, err := s.f.GetSection(sname)
|
||||||
|
if err != nil {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
parentKeys = append(parentKeys, sec.Keys()...)
|
||||||
|
} else {
|
||||||
|
break
|
||||||
|
}
|
||||||
|
|
||||||
|
}
|
||||||
|
return parentKeys
|
||||||
|
}
|
||||||
|
|
||||||
|
// KeyStrings returns list of key names of section.
|
||||||
|
func (s *Section) KeyStrings() []string {
|
||||||
|
list := make([]string, len(s.keyList))
|
||||||
|
copy(list, s.keyList)
|
||||||
|
return list
|
||||||
|
}
|
||||||
|
|
||||||
|
// KeysHash returns keys hash consisting of names and values.
|
||||||
|
func (s *Section) KeysHash() map[string]string {
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.RLock()
|
||||||
|
defer s.f.lock.RUnlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
hash := make(map[string]string, len(s.keysHash))
|
||||||
|
for key, value := range s.keysHash {
|
||||||
|
hash[key] = value
|
||||||
|
}
|
||||||
|
return hash
|
||||||
|
}
|
||||||
|
|
||||||
|
// DeleteKey deletes a key from section.
|
||||||
|
func (s *Section) DeleteKey(name string) {
|
||||||
|
if s.f.BlockMode {
|
||||||
|
s.f.lock.Lock()
|
||||||
|
defer s.f.lock.Unlock()
|
||||||
|
}
|
||||||
|
|
||||||
|
for i, k := range s.keyList {
|
||||||
|
if k == name {
|
||||||
|
s.keyList = append(s.keyList[:i], s.keyList[i+1:]...)
|
||||||
|
delete(s.keys, name)
|
||||||
|
delete(s.keysHash, name)
|
||||||
|
return
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// ChildSections returns a list of child sections of current section.
|
||||||
|
// For example, "[parent.child1]" and "[parent.child12]" are child sections
|
||||||
|
// of section "[parent]".
|
||||||
|
func (s *Section) ChildSections() []*Section {
|
||||||
|
prefix := s.name + s.f.options.ChildSectionDelimiter
|
||||||
|
children := make([]*Section, 0, 3)
|
||||||
|
for _, name := range s.f.sectionList {
|
||||||
|
if strings.HasPrefix(name, prefix) {
|
||||||
|
children = append(children, s.f.sections[name]...)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return children
|
||||||
|
}
|
|
@ -0,0 +1,747 @@
|
||||||
|
// Copyright 2014 Unknwon
|
||||||
|
//
|
||||||
|
// Licensed under the Apache License, Version 2.0 (the "License"): you may
|
||||||
|
// not use this file except in compliance with the License. You may obtain
|
||||||
|
// a copy of the License at
|
||||||
|
//
|
||||||
|
// http://www.apache.org/licenses/LICENSE-2.0
|
||||||
|
//
|
||||||
|
// Unless required by applicable law or agreed to in writing, software
|
||||||
|
// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
|
||||||
|
// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
|
||||||
|
// License for the specific language governing permissions and limitations
|
||||||
|
// under the License.
|
||||||
|
|
||||||
|
package ini
|
||||||
|
|
||||||
|
import (
|
||||||
|
"bytes"
|
||||||
|
"errors"
|
||||||
|
"fmt"
|
||||||
|
"reflect"
|
||||||
|
"strings"
|
||||||
|
"time"
|
||||||
|
"unicode"
|
||||||
|
)
|
||||||
|
|
||||||
|
// NameMapper represents a ini tag name mapper.
|
||||||
|
type NameMapper func(string) string
|
||||||
|
|
||||||
|
// Built-in name getters.
|
||||||
|
var (
|
||||||
|
// SnackCase converts to format SNACK_CASE.
|
||||||
|
SnackCase NameMapper = func(raw string) string {
|
||||||
|
newstr := make([]rune, 0, len(raw))
|
||||||
|
for i, chr := range raw {
|
||||||
|
if isUpper := 'A' <= chr && chr <= 'Z'; isUpper {
|
||||||
|
if i > 0 {
|
||||||
|
newstr = append(newstr, '_')
|
||||||
|
}
|
||||||
|
}
|
||||||
|
newstr = append(newstr, unicode.ToUpper(chr))
|
||||||
|
}
|
||||||
|
return string(newstr)
|
||||||
|
}
|
||||||
|
// TitleUnderscore converts to format title_underscore.
|
||||||
|
TitleUnderscore NameMapper = func(raw string) string {
|
||||||
|
newstr := make([]rune, 0, len(raw))
|
||||||
|
for i, chr := range raw {
|
||||||
|
if isUpper := 'A' <= chr && chr <= 'Z'; isUpper {
|
||||||
|
if i > 0 {
|
||||||
|
newstr = append(newstr, '_')
|
||||||
|
}
|
||||||
|
chr -= 'A' - 'a'
|
||||||
|
}
|
||||||
|
newstr = append(newstr, chr)
|
||||||
|
}
|
||||||
|
return string(newstr)
|
||||||
|
}
|
||||||
|
)
|
||||||
|
|
||||||
|
func (s *Section) parseFieldName(raw, actual string) string {
|
||||||
|
if len(actual) > 0 {
|
||||||
|
return actual
|
||||||
|
}
|
||||||
|
if s.f.NameMapper != nil {
|
||||||
|
return s.f.NameMapper(raw)
|
||||||
|
}
|
||||||
|
return raw
|
||||||
|
}
|
||||||
|
|
||||||
|
func parseDelim(actual string) string {
|
||||||
|
if len(actual) > 0 {
|
||||||
|
return actual
|
||||||
|
}
|
||||||
|
return ","
|
||||||
|
}
|
||||||
|
|
||||||
|
var reflectTime = reflect.TypeOf(time.Now()).Kind()
|
||||||
|
|
||||||
|
// setSliceWithProperType sets proper values to slice based on its type.
|
||||||
|
func setSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error {
|
||||||
|
var strs []string
|
||||||
|
if allowShadow {
|
||||||
|
strs = key.StringsWithShadows(delim)
|
||||||
|
} else {
|
||||||
|
strs = key.Strings(delim)
|
||||||
|
}
|
||||||
|
|
||||||
|
numVals := len(strs)
|
||||||
|
if numVals == 0 {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
var vals interface{}
|
||||||
|
var err error
|
||||||
|
|
||||||
|
sliceOf := field.Type().Elem().Kind()
|
||||||
|
switch sliceOf {
|
||||||
|
case reflect.String:
|
||||||
|
vals = strs
|
||||||
|
case reflect.Int:
|
||||||
|
vals, err = key.parseInts(strs, true, false)
|
||||||
|
case reflect.Int64:
|
||||||
|
vals, err = key.parseInt64s(strs, true, false)
|
||||||
|
case reflect.Uint:
|
||||||
|
vals, err = key.parseUints(strs, true, false)
|
||||||
|
case reflect.Uint64:
|
||||||
|
vals, err = key.parseUint64s(strs, true, false)
|
||||||
|
case reflect.Float64:
|
||||||
|
vals, err = key.parseFloat64s(strs, true, false)
|
||||||
|
case reflect.Bool:
|
||||||
|
vals, err = key.parseBools(strs, true, false)
|
||||||
|
case reflectTime:
|
||||||
|
vals, err = key.parseTimesFormat(time.RFC3339, strs, true, false)
|
||||||
|
default:
|
||||||
|
return fmt.Errorf("unsupported type '[]%s'", sliceOf)
|
||||||
|
}
|
||||||
|
if err != nil && isStrict {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
slice := reflect.MakeSlice(field.Type(), numVals, numVals)
|
||||||
|
for i := 0; i < numVals; i++ {
|
||||||
|
switch sliceOf {
|
||||||
|
case reflect.String:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]string)[i]))
|
||||||
|
case reflect.Int:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]int)[i]))
|
||||||
|
case reflect.Int64:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]int64)[i]))
|
||||||
|
case reflect.Uint:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]uint)[i]))
|
||||||
|
case reflect.Uint64:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]uint64)[i]))
|
||||||
|
case reflect.Float64:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]float64)[i]))
|
||||||
|
case reflect.Bool:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]bool)[i]))
|
||||||
|
case reflectTime:
|
||||||
|
slice.Index(i).Set(reflect.ValueOf(vals.([]time.Time)[i]))
|
||||||
|
}
|
||||||
|
}
|
||||||
|
field.Set(slice)
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func wrapStrictError(err error, isStrict bool) error {
|
||||||
|
if isStrict {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// setWithProperType sets proper value to field based on its type,
|
||||||
|
// but it does not return error for failing parsing,
|
||||||
|
// because we want to use default value that is already assigned to struct.
|
||||||
|
func setWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error {
|
||||||
|
vt := t
|
||||||
|
isPtr := t.Kind() == reflect.Ptr
|
||||||
|
if isPtr {
|
||||||
|
vt = t.Elem()
|
||||||
|
}
|
||||||
|
switch vt.Kind() {
|
||||||
|
case reflect.String:
|
||||||
|
stringVal := key.String()
|
||||||
|
if isPtr {
|
||||||
|
field.Set(reflect.ValueOf(&stringVal))
|
||||||
|
} else if len(stringVal) > 0 {
|
||||||
|
field.SetString(key.String())
|
||||||
|
}
|
||||||
|
case reflect.Bool:
|
||||||
|
boolVal, err := key.Bool()
|
||||||
|
if err != nil {
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
field.Set(reflect.ValueOf(&boolVal))
|
||||||
|
} else {
|
||||||
|
field.SetBool(boolVal)
|
||||||
|
}
|
||||||
|
case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
|
||||||
|
// ParseDuration will not return err for `0`, so check the type name
|
||||||
|
if vt.Name() == "Duration" {
|
||||||
|
durationVal, err := key.Duration()
|
||||||
|
if err != nil {
|
||||||
|
if intVal, err := key.Int64(); err == nil {
|
||||||
|
field.SetInt(intVal)
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
field.Set(reflect.ValueOf(&durationVal))
|
||||||
|
} else if int64(durationVal) > 0 {
|
||||||
|
field.Set(reflect.ValueOf(durationVal))
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
intVal, err := key.Int64()
|
||||||
|
if err != nil {
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
pv := reflect.New(t.Elem())
|
||||||
|
pv.Elem().SetInt(intVal)
|
||||||
|
field.Set(pv)
|
||||||
|
} else {
|
||||||
|
field.SetInt(intVal)
|
||||||
|
}
|
||||||
|
// byte is an alias for uint8, so supporting uint8 breaks support for byte
|
||||||
|
case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64:
|
||||||
|
durationVal, err := key.Duration()
|
||||||
|
// Skip zero value
|
||||||
|
if err == nil && uint64(durationVal) > 0 {
|
||||||
|
if isPtr {
|
||||||
|
field.Set(reflect.ValueOf(&durationVal))
|
||||||
|
} else {
|
||||||
|
field.Set(reflect.ValueOf(durationVal))
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
uintVal, err := key.Uint64()
|
||||||
|
if err != nil {
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
pv := reflect.New(t.Elem())
|
||||||
|
pv.Elem().SetUint(uintVal)
|
||||||
|
field.Set(pv)
|
||||||
|
} else {
|
||||||
|
field.SetUint(uintVal)
|
||||||
|
}
|
||||||
|
|
||||||
|
case reflect.Float32, reflect.Float64:
|
||||||
|
floatVal, err := key.Float64()
|
||||||
|
if err != nil {
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
pv := reflect.New(t.Elem())
|
||||||
|
pv.Elem().SetFloat(floatVal)
|
||||||
|
field.Set(pv)
|
||||||
|
} else {
|
||||||
|
field.SetFloat(floatVal)
|
||||||
|
}
|
||||||
|
case reflectTime:
|
||||||
|
timeVal, err := key.Time()
|
||||||
|
if err != nil {
|
||||||
|
return wrapStrictError(err, isStrict)
|
||||||
|
}
|
||||||
|
if isPtr {
|
||||||
|
field.Set(reflect.ValueOf(&timeVal))
|
||||||
|
} else {
|
||||||
|
field.Set(reflect.ValueOf(timeVal))
|
||||||
|
}
|
||||||
|
case reflect.Slice:
|
||||||
|
return setSliceWithProperType(key, field, delim, allowShadow, isStrict)
|
||||||
|
default:
|
||||||
|
return fmt.Errorf("unsupported type %q", t)
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
func parseTagOptions(tag string) (rawName string, omitEmpty bool, allowShadow bool, allowNonUnique bool, extends bool) {
|
||||||
|
opts := strings.SplitN(tag, ",", 5)
|
||||||
|
rawName = opts[0]
|
||||||
|
for _, opt := range opts[1:] {
|
||||||
|
omitEmpty = omitEmpty || (opt == "omitempty")
|
||||||
|
allowShadow = allowShadow || (opt == "allowshadow")
|
||||||
|
allowNonUnique = allowNonUnique || (opt == "nonunique")
|
||||||
|
extends = extends || (opt == "extends")
|
||||||
|
}
|
||||||
|
return rawName, omitEmpty, allowShadow, allowNonUnique, extends
|
||||||
|
}
|
||||||
|
|
||||||
|
// mapToField maps the given value to the matching field of the given section.
|
||||||
|
// The sectionIndex is the index (if non unique sections are enabled) to which the value should be added.
|
||||||
|
func (s *Section) mapToField(val reflect.Value, isStrict bool, sectionIndex int, sectionName string) error {
|
||||||
|
if val.Kind() == reflect.Ptr {
|
||||||
|
val = val.Elem()
|
||||||
|
}
|
||||||
|
typ := val.Type()
|
||||||
|
|
||||||
|
for i := 0; i < typ.NumField(); i++ {
|
||||||
|
field := val.Field(i)
|
||||||
|
tpField := typ.Field(i)
|
||||||
|
|
||||||
|
tag := tpField.Tag.Get("ini")
|
||||||
|
if tag == "-" {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
rawName, _, allowShadow, allowNonUnique, extends := parseTagOptions(tag)
|
||||||
|
fieldName := s.parseFieldName(tpField.Name, rawName)
|
||||||
|
if len(fieldName) == 0 || !field.CanSet() {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
isStruct := tpField.Type.Kind() == reflect.Struct
|
||||||
|
isStructPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct
|
||||||
|
isAnonymousPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Anonymous
|
||||||
|
if isAnonymousPtr {
|
||||||
|
field.Set(reflect.New(tpField.Type.Elem()))
|
||||||
|
}
|
||||||
|
|
||||||
|
if extends && (isAnonymousPtr || (isStruct && tpField.Anonymous)) {
|
||||||
|
if isStructPtr && field.IsNil() {
|
||||||
|
field.Set(reflect.New(tpField.Type.Elem()))
|
||||||
|
}
|
||||||
|
fieldSection := s
|
||||||
|
if rawName != "" {
|
||||||
|
sectionName = s.name + s.f.options.ChildSectionDelimiter + rawName
|
||||||
|
if secs, err := s.f.SectionsByName(sectionName); err == nil && sectionIndex < len(secs) {
|
||||||
|
fieldSection = secs[sectionIndex]
|
||||||
|
}
|
||||||
|
}
|
||||||
|
if err := fieldSection.mapToField(field, isStrict, sectionIndex, sectionName); err != nil {
|
||||||
|
return fmt.Errorf("map to field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
} else if isAnonymousPtr || isStruct || isStructPtr {
|
||||||
|
if secs, err := s.f.SectionsByName(fieldName); err == nil {
|
||||||
|
if len(secs) <= sectionIndex {
|
||||||
|
return fmt.Errorf("there are not enough sections (%d <= %d) for the field %q", len(secs), sectionIndex, fieldName)
|
||||||
|
}
|
||||||
|
// Only set the field to non-nil struct value if we have a section for it.
|
||||||
|
// Otherwise, we end up with a non-nil struct ptr even though there is no data.
|
||||||
|
if isStructPtr && field.IsNil() {
|
||||||
|
field.Set(reflect.New(tpField.Type.Elem()))
|
||||||
|
}
|
||||||
|
if err = secs[sectionIndex].mapToField(field, isStrict, sectionIndex, fieldName); err != nil {
|
||||||
|
return fmt.Errorf("map to field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
// Map non-unique sections
|
||||||
|
if allowNonUnique && tpField.Type.Kind() == reflect.Slice {
|
||||||
|
newField, err := s.mapToSlice(fieldName, field, isStrict)
|
||||||
|
if err != nil {
|
||||||
|
return fmt.Errorf("map to slice %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
|
||||||
|
field.Set(newField)
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if key, err := s.GetKey(fieldName); err == nil {
|
||||||
|
delim := parseDelim(tpField.Tag.Get("delim"))
|
||||||
|
if err = setWithProperType(tpField.Type, key, field, delim, allowShadow, isStrict); err != nil {
|
||||||
|
return fmt.Errorf("set field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// mapToSlice maps all sections with the same name and returns the new value.
|
||||||
|
// The type of the Value must be a slice.
|
||||||
|
func (s *Section) mapToSlice(secName string, val reflect.Value, isStrict bool) (reflect.Value, error) {
|
||||||
|
secs, err := s.f.SectionsByName(secName)
|
||||||
|
if err != nil {
|
||||||
|
return reflect.Value{}, err
|
||||||
|
}
|
||||||
|
|
||||||
|
typ := val.Type().Elem()
|
||||||
|
for i, sec := range secs {
|
||||||
|
elem := reflect.New(typ)
|
||||||
|
if err = sec.mapToField(elem, isStrict, i, sec.name); err != nil {
|
||||||
|
return reflect.Value{}, fmt.Errorf("map to field from section %q: %v", secName, err)
|
||||||
|
}
|
||||||
|
|
||||||
|
val = reflect.Append(val, elem.Elem())
|
||||||
|
}
|
||||||
|
return val, nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// mapTo maps a section to object v.
|
||||||
|
func (s *Section) mapTo(v interface{}, isStrict bool) error {
|
||||||
|
typ := reflect.TypeOf(v)
|
||||||
|
val := reflect.ValueOf(v)
|
||||||
|
if typ.Kind() == reflect.Ptr {
|
||||||
|
typ = typ.Elem()
|
||||||
|
val = val.Elem()
|
||||||
|
} else {
|
||||||
|
return errors.New("not a pointer to a struct")
|
||||||
|
}
|
||||||
|
|
||||||
|
if typ.Kind() == reflect.Slice {
|
||||||
|
newField, err := s.mapToSlice(s.name, val, isStrict)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
val.Set(newField)
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
return s.mapToField(val, isStrict, 0, s.name)
|
||||||
|
}
|
||||||
|
|
||||||
|
// MapTo maps section to given struct.
|
||||||
|
func (s *Section) MapTo(v interface{}) error {
|
||||||
|
return s.mapTo(v, false)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictMapTo maps section to given struct in strict mode,
|
||||||
|
// which returns all possible error including value parsing error.
|
||||||
|
func (s *Section) StrictMapTo(v interface{}) error {
|
||||||
|
return s.mapTo(v, true)
|
||||||
|
}
|
||||||
|
|
||||||
|
// MapTo maps file to given struct.
|
||||||
|
func (f *File) MapTo(v interface{}) error {
|
||||||
|
return f.Section("").MapTo(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictMapTo maps file to given struct in strict mode,
|
||||||
|
// which returns all possible error including value parsing error.
|
||||||
|
func (f *File) StrictMapTo(v interface{}) error {
|
||||||
|
return f.Section("").StrictMapTo(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// MapToWithMapper maps data sources to given struct with name mapper.
|
||||||
|
func MapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error {
|
||||||
|
cfg, err := Load(source, others...)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
cfg.NameMapper = mapper
|
||||||
|
return cfg.MapTo(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictMapToWithMapper maps data sources to given struct with name mapper in strict mode,
|
||||||
|
// which returns all possible error including value parsing error.
|
||||||
|
func StrictMapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error {
|
||||||
|
cfg, err := Load(source, others...)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
cfg.NameMapper = mapper
|
||||||
|
return cfg.StrictMapTo(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// MapTo maps data sources to given struct.
|
||||||
|
func MapTo(v, source interface{}, others ...interface{}) error {
|
||||||
|
return MapToWithMapper(v, nil, source, others...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// StrictMapTo maps data sources to given struct in strict mode,
|
||||||
|
// which returns all possible error including value parsing error.
|
||||||
|
func StrictMapTo(v, source interface{}, others ...interface{}) error {
|
||||||
|
return StrictMapToWithMapper(v, nil, source, others...)
|
||||||
|
}
|
||||||
|
|
||||||
|
// reflectSliceWithProperType does the opposite thing as setSliceWithProperType.
|
||||||
|
func reflectSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow bool) error {
|
||||||
|
slice := field.Slice(0, field.Len())
|
||||||
|
if field.Len() == 0 {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
sliceOf := field.Type().Elem().Kind()
|
||||||
|
|
||||||
|
if allowShadow {
|
||||||
|
var keyWithShadows *Key
|
||||||
|
for i := 0; i < field.Len(); i++ {
|
||||||
|
var val string
|
||||||
|
switch sliceOf {
|
||||||
|
case reflect.String:
|
||||||
|
val = slice.Index(i).String()
|
||||||
|
case reflect.Int, reflect.Int64:
|
||||||
|
val = fmt.Sprint(slice.Index(i).Int())
|
||||||
|
case reflect.Uint, reflect.Uint64:
|
||||||
|
val = fmt.Sprint(slice.Index(i).Uint())
|
||||||
|
case reflect.Float64:
|
||||||
|
val = fmt.Sprint(slice.Index(i).Float())
|
||||||
|
case reflect.Bool:
|
||||||
|
val = fmt.Sprint(slice.Index(i).Bool())
|
||||||
|
case reflectTime:
|
||||||
|
val = slice.Index(i).Interface().(time.Time).Format(time.RFC3339)
|
||||||
|
default:
|
||||||
|
return fmt.Errorf("unsupported type '[]%s'", sliceOf)
|
||||||
|
}
|
||||||
|
|
||||||
|
if i == 0 {
|
||||||
|
keyWithShadows = newKey(key.s, key.name, val)
|
||||||
|
} else {
|
||||||
|
_ = keyWithShadows.AddShadow(val)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
*key = *keyWithShadows
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
var buf bytes.Buffer
|
||||||
|
for i := 0; i < field.Len(); i++ {
|
||||||
|
switch sliceOf {
|
||||||
|
case reflect.String:
|
||||||
|
buf.WriteString(slice.Index(i).String())
|
||||||
|
case reflect.Int, reflect.Int64:
|
||||||
|
buf.WriteString(fmt.Sprint(slice.Index(i).Int()))
|
||||||
|
case reflect.Uint, reflect.Uint64:
|
||||||
|
buf.WriteString(fmt.Sprint(slice.Index(i).Uint()))
|
||||||
|
case reflect.Float64:
|
||||||
|
buf.WriteString(fmt.Sprint(slice.Index(i).Float()))
|
||||||
|
case reflect.Bool:
|
||||||
|
buf.WriteString(fmt.Sprint(slice.Index(i).Bool()))
|
||||||
|
case reflectTime:
|
||||||
|
buf.WriteString(slice.Index(i).Interface().(time.Time).Format(time.RFC3339))
|
||||||
|
default:
|
||||||
|
return fmt.Errorf("unsupported type '[]%s'", sliceOf)
|
||||||
|
}
|
||||||
|
buf.WriteString(delim)
|
||||||
|
}
|
||||||
|
key.SetValue(buf.String()[:buf.Len()-len(delim)])
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// reflectWithProperType does the opposite thing as setWithProperType.
|
||||||
|
func reflectWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow bool) error {
|
||||||
|
switch t.Kind() {
|
||||||
|
case reflect.String:
|
||||||
|
key.SetValue(field.String())
|
||||||
|
case reflect.Bool:
|
||||||
|
key.SetValue(fmt.Sprint(field.Bool()))
|
||||||
|
case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
|
||||||
|
key.SetValue(fmt.Sprint(field.Int()))
|
||||||
|
case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
|
||||||
|
key.SetValue(fmt.Sprint(field.Uint()))
|
||||||
|
case reflect.Float32, reflect.Float64:
|
||||||
|
key.SetValue(fmt.Sprint(field.Float()))
|
||||||
|
case reflectTime:
|
||||||
|
key.SetValue(fmt.Sprint(field.Interface().(time.Time).Format(time.RFC3339)))
|
||||||
|
case reflect.Slice:
|
||||||
|
return reflectSliceWithProperType(key, field, delim, allowShadow)
|
||||||
|
case reflect.Ptr:
|
||||||
|
if !field.IsNil() {
|
||||||
|
return reflectWithProperType(t.Elem(), key, field.Elem(), delim, allowShadow)
|
||||||
|
}
|
||||||
|
default:
|
||||||
|
return fmt.Errorf("unsupported type %q", t)
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// CR: copied from encoding/json/encode.go with modifications of time.Time support.
|
||||||
|
// TODO: add more test coverage.
|
||||||
|
func isEmptyValue(v reflect.Value) bool {
|
||||||
|
switch v.Kind() {
|
||||||
|
case reflect.Array, reflect.Map, reflect.Slice, reflect.String:
|
||||||
|
return v.Len() == 0
|
||||||
|
case reflect.Bool:
|
||||||
|
return !v.Bool()
|
||||||
|
case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
|
||||||
|
return v.Int() == 0
|
||||||
|
case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr:
|
||||||
|
return v.Uint() == 0
|
||||||
|
case reflect.Float32, reflect.Float64:
|
||||||
|
return v.Float() == 0
|
||||||
|
case reflect.Interface, reflect.Ptr:
|
||||||
|
return v.IsNil()
|
||||||
|
case reflectTime:
|
||||||
|
t, ok := v.Interface().(time.Time)
|
||||||
|
return ok && t.IsZero()
|
||||||
|
}
|
||||||
|
return false
|
||||||
|
}
|
||||||
|
|
||||||
|
// StructReflector is the interface implemented by struct types that can extract themselves into INI objects.
|
||||||
|
type StructReflector interface {
|
||||||
|
ReflectINIStruct(*File) error
|
||||||
|
}
|
||||||
|
|
||||||
|
func (s *Section) reflectFrom(val reflect.Value) error {
|
||||||
|
if val.Kind() == reflect.Ptr {
|
||||||
|
val = val.Elem()
|
||||||
|
}
|
||||||
|
typ := val.Type()
|
||||||
|
|
||||||
|
for i := 0; i < typ.NumField(); i++ {
|
||||||
|
if !val.Field(i).CanInterface() {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
field := val.Field(i)
|
||||||
|
tpField := typ.Field(i)
|
||||||
|
|
||||||
|
tag := tpField.Tag.Get("ini")
|
||||||
|
if tag == "-" {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
rawName, omitEmpty, allowShadow, allowNonUnique, extends := parseTagOptions(tag)
|
||||||
|
if omitEmpty && isEmptyValue(field) {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if r, ok := field.Interface().(StructReflector); ok {
|
||||||
|
return r.ReflectINIStruct(s.f)
|
||||||
|
}
|
||||||
|
|
||||||
|
fieldName := s.parseFieldName(tpField.Name, rawName)
|
||||||
|
if len(fieldName) == 0 || !field.CanSet() {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if extends && tpField.Anonymous && (tpField.Type.Kind() == reflect.Ptr || tpField.Type.Kind() == reflect.Struct) {
|
||||||
|
if err := s.reflectFrom(field); err != nil {
|
||||||
|
return fmt.Errorf("reflect from field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if (tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct) ||
|
||||||
|
(tpField.Type.Kind() == reflect.Struct && tpField.Type.Name() != "Time") {
|
||||||
|
// Note: The only error here is section doesn't exist.
|
||||||
|
sec, err := s.f.GetSection(fieldName)
|
||||||
|
if err != nil {
|
||||||
|
// Note: fieldName can never be empty here, ignore error.
|
||||||
|
sec, _ = s.f.NewSection(fieldName)
|
||||||
|
}
|
||||||
|
|
||||||
|
// Add comment from comment tag
|
||||||
|
if len(sec.Comment) == 0 {
|
||||||
|
sec.Comment = tpField.Tag.Get("comment")
|
||||||
|
}
|
||||||
|
|
||||||
|
if err = sec.reflectFrom(field); err != nil {
|
||||||
|
return fmt.Errorf("reflect from field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
if allowNonUnique && tpField.Type.Kind() == reflect.Slice {
|
||||||
|
slice := field.Slice(0, field.Len())
|
||||||
|
if field.Len() == 0 {
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
sliceOf := field.Type().Elem().Kind()
|
||||||
|
|
||||||
|
for i := 0; i < field.Len(); i++ {
|
||||||
|
if sliceOf != reflect.Struct && sliceOf != reflect.Ptr {
|
||||||
|
return fmt.Errorf("field %q is not a slice of pointer or struct", fieldName)
|
||||||
|
}
|
||||||
|
|
||||||
|
sec, err := s.f.NewSection(fieldName)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
// Add comment from comment tag
|
||||||
|
if len(sec.Comment) == 0 {
|
||||||
|
sec.Comment = tpField.Tag.Get("comment")
|
||||||
|
}
|
||||||
|
|
||||||
|
if err := sec.reflectFrom(slice.Index(i)); err != nil {
|
||||||
|
return fmt.Errorf("reflect from field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
|
||||||
|
// Note: Same reason as section.
|
||||||
|
key, err := s.GetKey(fieldName)
|
||||||
|
if err != nil {
|
||||||
|
key, _ = s.NewKey(fieldName, "")
|
||||||
|
}
|
||||||
|
|
||||||
|
// Add comment from comment tag
|
||||||
|
if len(key.Comment) == 0 {
|
||||||
|
key.Comment = tpField.Tag.Get("comment")
|
||||||
|
}
|
||||||
|
|
||||||
|
delim := parseDelim(tpField.Tag.Get("delim"))
|
||||||
|
if err = reflectWithProperType(tpField.Type, key, field, delim, allowShadow); err != nil {
|
||||||
|
return fmt.Errorf("reflect field %q: %v", fieldName, err)
|
||||||
|
}
|
||||||
|
|
||||||
|
}
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
// ReflectFrom reflects section from given struct. It overwrites existing ones.
|
||||||
|
func (s *Section) ReflectFrom(v interface{}) error {
|
||||||
|
typ := reflect.TypeOf(v)
|
||||||
|
val := reflect.ValueOf(v)
|
||||||
|
|
||||||
|
if s.name != DefaultSection && s.f.options.AllowNonUniqueSections &&
|
||||||
|
(typ.Kind() == reflect.Slice || typ.Kind() == reflect.Ptr) {
|
||||||
|
// Clear sections to make sure none exists before adding the new ones
|
||||||
|
s.f.DeleteSection(s.name)
|
||||||
|
|
||||||
|
if typ.Kind() == reflect.Ptr {
|
||||||
|
sec, err := s.f.NewSection(s.name)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
return sec.reflectFrom(val.Elem())
|
||||||
|
}
|
||||||
|
|
||||||
|
slice := val.Slice(0, val.Len())
|
||||||
|
sliceOf := val.Type().Elem().Kind()
|
||||||
|
if sliceOf != reflect.Ptr {
|
||||||
|
return fmt.Errorf("not a slice of pointers")
|
||||||
|
}
|
||||||
|
|
||||||
|
for i := 0; i < slice.Len(); i++ {
|
||||||
|
sec, err := s.f.NewSection(s.name)
|
||||||
|
if err != nil {
|
||||||
|
return err
|
||||||
|
}
|
||||||
|
|
||||||
|
err = sec.reflectFrom(slice.Index(i))
|
||||||
|
if err != nil {
|
||||||
|
return fmt.Errorf("reflect from %dth field: %v", i, err)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
|
||||||
|
return nil
|
||||||
|
}
|
||||||
|
|
||||||
|
if typ.Kind() == reflect.Ptr {
|
||||||
|
val = val.Elem()
|
||||||
|
} else {
|
||||||
|
return errors.New("not a pointer to a struct")
|
||||||
|
}
|
||||||
|
|
||||||
|
return s.reflectFrom(val)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ReflectFrom reflects file from given struct.
|
||||||
|
func (f *File) ReflectFrom(v interface{}) error {
|
||||||
|
return f.Section("").ReflectFrom(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ReflectFromWithMapper reflects data sources from given struct with name mapper.
|
||||||
|
func ReflectFromWithMapper(cfg *File, v interface{}, mapper NameMapper) error {
|
||||||
|
cfg.NameMapper = mapper
|
||||||
|
return cfg.ReflectFrom(v)
|
||||||
|
}
|
||||||
|
|
||||||
|
// ReflectFrom reflects data sources from given struct.
|
||||||
|
func ReflectFrom(cfg *File, v interface{}) error {
|
||||||
|
return ReflectFromWithMapper(cfg, v, nil)
|
||||||
|
}
|
|
@ -56,6 +56,9 @@ linters:
|
||||||
- cyclop
|
- cyclop
|
||||||
- containedctx
|
- containedctx
|
||||||
- revive
|
- revive
|
||||||
|
- nosnakecase
|
||||||
|
- exhaustruct
|
||||||
|
- depguard
|
||||||
|
|
||||||
issues:
|
issues:
|
||||||
exclude-rules:
|
exclude-rules:
|
||||||
|
|
|
@ -30,7 +30,7 @@ golangci-lint: | $(BIN_DIR)
|
||||||
GOLANGCI_LINT_TMP_DIR=$$(mktemp -d); \
|
GOLANGCI_LINT_TMP_DIR=$$(mktemp -d); \
|
||||||
cd $$GOLANGCI_LINT_TMP_DIR; \
|
cd $$GOLANGCI_LINT_TMP_DIR; \
|
||||||
go mod init tmp; \
|
go mod init tmp; \
|
||||||
GOBIN=$(BIN_DIR) go install github.com/golangci/golangci-lint/cmd/golangci-lint@v1.48.0; \
|
GOBIN=$(BIN_DIR) go install github.com/golangci/golangci-lint/cmd/golangci-lint@v1.54.2; \
|
||||||
rm -rf $$GOLANGCI_LINT_TMP_DIR; \
|
rm -rf $$GOLANGCI_LINT_TMP_DIR; \
|
||||||
}
|
}
|
||||||
|
|
||||||
|
|
|
@ -52,7 +52,7 @@ func (e *Encoder) EncodeContext(ctx context.Context, v interface{}, optFuncs ...
|
||||||
rctx.Option.Flag |= encoder.ContextOption
|
rctx.Option.Flag |= encoder.ContextOption
|
||||||
rctx.Option.Context = ctx
|
rctx.Option.Context = ctx
|
||||||
|
|
||||||
err := e.encodeWithOption(rctx, v, optFuncs...)
|
err := e.encodeWithOption(rctx, v, optFuncs...) //nolint: contextcheck
|
||||||
|
|
||||||
encoder.ReleaseRuntimeContext(rctx)
|
encoder.ReleaseRuntimeContext(rctx)
|
||||||
return err
|
return err
|
||||||
|
@ -120,7 +120,7 @@ func marshalContext(ctx context.Context, v interface{}, optFuncs ...EncodeOption
|
||||||
optFunc(rctx.Option)
|
optFunc(rctx.Option)
|
||||||
}
|
}
|
||||||
|
|
||||||
buf, err := encode(rctx, v)
|
buf, err := encode(rctx, v) //nolint: contextcheck
|
||||||
if err != nil {
|
if err != nil {
|
||||||
encoder.ReleaseRuntimeContext(rctx)
|
encoder.ReleaseRuntimeContext(rctx)
|
||||||
return nil, err
|
return nil, err
|
||||||
|
|
|
@ -85,6 +85,7 @@ func (d *ptrDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.P
|
||||||
}
|
}
|
||||||
c, err := d.dec.Decode(ctx, cursor, depth, newptr)
|
c, err := d.dec.Decode(ctx, cursor, depth, newptr)
|
||||||
if err != nil {
|
if err != nil {
|
||||||
|
*(*unsafe.Pointer)(p) = nil
|
||||||
return 0, err
|
return 0, err
|
||||||
}
|
}
|
||||||
cursor = c
|
cursor = c
|
||||||
|
|
|
@ -147,7 +147,7 @@ func (d *unmarshalTextDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int
|
||||||
return nil, 0, fmt.Errorf("json: unmarshal text decoder does not support decode path")
|
return nil, 0, fmt.Errorf("json: unmarshal text decoder does not support decode path")
|
||||||
}
|
}
|
||||||
|
|
||||||
func unquoteBytes(s []byte) (t []byte, ok bool) {
|
func unquoteBytes(s []byte) (t []byte, ok bool) { //nolint: nonamedreturns
|
||||||
length := len(s)
|
length := len(s)
|
||||||
if length < 2 || s[0] != '"' || s[length-1] != '"' {
|
if length < 2 || s[0] != '"' || s[length-1] != '"' {
|
||||||
return
|
return
|
||||||
|
|
|
@ -213,8 +213,8 @@ func compactString(dst, src []byte, cursor int64, escape bool) ([]byte, int64, e
|
||||||
dst = append(dst, src[start:cursor]...)
|
dst = append(dst, src[start:cursor]...)
|
||||||
dst = append(dst, `\u202`...)
|
dst = append(dst, `\u202`...)
|
||||||
dst = append(dst, hex[src[cursor+2]&0xF])
|
dst = append(dst, hex[src[cursor+2]&0xF])
|
||||||
cursor += 2
|
|
||||||
start = cursor + 3
|
start = cursor + 3
|
||||||
|
cursor += 2
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
switch c {
|
switch c {
|
||||||
|
|
|
@ -480,7 +480,7 @@ func (c *Compiler) mapCode(typ *runtime.Type) (*MapCode, error) {
|
||||||
|
|
||||||
func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) {
|
func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) {
|
||||||
switch {
|
switch {
|
||||||
case c.isPtrMarshalJSONType(typ):
|
case c.implementsMarshalJSONType(typ) || c.implementsMarshalJSONType(runtime.PtrTo(typ)):
|
||||||
return c.marshalJSONCode(typ)
|
return c.marshalJSONCode(typ)
|
||||||
case !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType):
|
case !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType):
|
||||||
return c.marshalTextCode(typ)
|
return c.marshalTextCode(typ)
|
||||||
|
|
|
@ -1,3 +1,27 @@
|
||||||
|
// This files's processing codes are inspired by https://github.com/segmentio/encoding.
|
||||||
|
// The license notation is as follows.
|
||||||
|
//
|
||||||
|
// # MIT License
|
||||||
|
//
|
||||||
|
// Copyright (c) 2019 Segment.io, Inc.
|
||||||
|
//
|
||||||
|
// Permission is hereby granted, free of charge, to any person obtaining a copy
|
||||||
|
// of this software and associated documentation files (the "Software"), to deal
|
||||||
|
// in the Software without restriction, including without limitation the rights
|
||||||
|
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
|
||||||
|
// copies of the Software, and to permit persons to whom the Software is
|
||||||
|
// furnished to do so, subject to the following conditions:
|
||||||
|
//
|
||||||
|
// The above copyright notice and this permission notice shall be included in all
|
||||||
|
// copies or substantial portions of the Software.
|
||||||
|
//
|
||||||
|
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
|
||||||
|
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
|
||||||
|
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
|
||||||
|
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
|
||||||
|
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
|
||||||
|
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
|
||||||
|
// SOFTWARE.
|
||||||
package encoder
|
package encoder
|
||||||
|
|
||||||
import (
|
import (
|
||||||
|
|
|
@ -1,3 +1,27 @@
|
||||||
|
// This files's string processing codes are inspired by https://github.com/segmentio/encoding.
|
||||||
|
// The license notation is as follows.
|
||||||
|
//
|
||||||
|
// # MIT License
|
||||||
|
//
|
||||||
|
// Copyright (c) 2019 Segment.io, Inc.
|
||||||
|
//
|
||||||
|
// Permission is hereby granted, free of charge, to any person obtaining a copy
|
||||||
|
// of this software and associated documentation files (the "Software"), to deal
|
||||||
|
// in the Software without restriction, including without limitation the rights
|
||||||
|
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
|
||||||
|
// copies of the Software, and to permit persons to whom the Software is
|
||||||
|
// furnished to do so, subject to the following conditions:
|
||||||
|
//
|
||||||
|
// The above copyright notice and this permission notice shall be included in all
|
||||||
|
// copies or substantial portions of the Software.
|
||||||
|
//
|
||||||
|
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
|
||||||
|
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
|
||||||
|
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
|
||||||
|
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
|
||||||
|
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
|
||||||
|
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
|
||||||
|
// SOFTWARE.
|
||||||
package encoder
|
package encoder
|
||||||
|
|
||||||
import (
|
import (
|
||||||
|
|
|
@ -252,7 +252,6 @@ func IfaceIndir(*Type) bool
|
||||||
//go:noescape
|
//go:noescape
|
||||||
func RType2Type(t *Type) reflect.Type
|
func RType2Type(t *Type) reflect.Type
|
||||||
|
|
||||||
//go:nolint structcheck
|
|
||||||
type emptyInterface struct {
|
type emptyInterface struct {
|
||||||
_ *Type
|
_ *Type
|
||||||
ptr unsafe.Pointer
|
ptr unsafe.Pointer
|
||||||
|
|
|
@ -89,31 +89,31 @@ type UnmarshalerContext interface {
|
||||||
//
|
//
|
||||||
// Examples of struct field tags and their meanings:
|
// Examples of struct field tags and their meanings:
|
||||||
//
|
//
|
||||||
// // Field appears in JSON as key "myName".
|
// // Field appears in JSON as key "myName".
|
||||||
// Field int `json:"myName"`
|
// Field int `json:"myName"`
|
||||||
//
|
//
|
||||||
// // Field appears in JSON as key "myName" and
|
// // Field appears in JSON as key "myName" and
|
||||||
// // the field is omitted from the object if its value is empty,
|
// // the field is omitted from the object if its value is empty,
|
||||||
// // as defined above.
|
// // as defined above.
|
||||||
// Field int `json:"myName,omitempty"`
|
// Field int `json:"myName,omitempty"`
|
||||||
//
|
//
|
||||||
// // Field appears in JSON as key "Field" (the default), but
|
// // Field appears in JSON as key "Field" (the default), but
|
||||||
// // the field is skipped if empty.
|
// // the field is skipped if empty.
|
||||||
// // Note the leading comma.
|
// // Note the leading comma.
|
||||||
// Field int `json:",omitempty"`
|
// Field int `json:",omitempty"`
|
||||||
//
|
//
|
||||||
// // Field is ignored by this package.
|
// // Field is ignored by this package.
|
||||||
// Field int `json:"-"`
|
// Field int `json:"-"`
|
||||||
//
|
//
|
||||||
// // Field appears in JSON as key "-".
|
// // Field appears in JSON as key "-".
|
||||||
// Field int `json:"-,"`
|
// Field int `json:"-,"`
|
||||||
//
|
//
|
||||||
// The "string" option signals that a field is stored as JSON inside a
|
// The "string" option signals that a field is stored as JSON inside a
|
||||||
// JSON-encoded string. It applies only to fields of string, floating point,
|
// JSON-encoded string. It applies only to fields of string, floating point,
|
||||||
// integer, or boolean types. This extra level of encoding is sometimes used
|
// integer, or boolean types. This extra level of encoding is sometimes used
|
||||||
// when communicating with JavaScript programs:
|
// when communicating with JavaScript programs:
|
||||||
//
|
//
|
||||||
// Int64String int64 `json:",string"`
|
// Int64String int64 `json:",string"`
|
||||||
//
|
//
|
||||||
// The key name will be used if it's a non-empty string consisting of
|
// The key name will be used if it's a non-empty string consisting of
|
||||||
// only Unicode letters, digits, and ASCII punctuation except quotation
|
// only Unicode letters, digits, and ASCII punctuation except quotation
|
||||||
|
@ -166,7 +166,6 @@ type UnmarshalerContext interface {
|
||||||
// JSON cannot represent cyclic data structures and Marshal does not
|
// JSON cannot represent cyclic data structures and Marshal does not
|
||||||
// handle them. Passing cyclic structures to Marshal will result in
|
// handle them. Passing cyclic structures to Marshal will result in
|
||||||
// an infinite recursion.
|
// an infinite recursion.
|
||||||
//
|
|
||||||
func Marshal(v interface{}) ([]byte, error) {
|
func Marshal(v interface{}) ([]byte, error) {
|
||||||
return MarshalWithOption(v)
|
return MarshalWithOption(v)
|
||||||
}
|
}
|
||||||
|
@ -264,14 +263,13 @@ func MarshalIndentWithOption(v interface{}, prefix, indent string, optFuncs ...E
|
||||||
//
|
//
|
||||||
// The JSON null value unmarshals into an interface, map, pointer, or slice
|
// The JSON null value unmarshals into an interface, map, pointer, or slice
|
||||||
// by setting that Go value to nil. Because null is often used in JSON to mean
|
// by setting that Go value to nil. Because null is often used in JSON to mean
|
||||||
// ``not present,'' unmarshaling a JSON null into any other Go type has no effect
|
// “not present,” unmarshaling a JSON null into any other Go type has no effect
|
||||||
// on the value and produces no error.
|
// on the value and produces no error.
|
||||||
//
|
//
|
||||||
// When unmarshaling quoted strings, invalid UTF-8 or
|
// When unmarshaling quoted strings, invalid UTF-8 or
|
||||||
// invalid UTF-16 surrogate pairs are not treated as an error.
|
// invalid UTF-16 surrogate pairs are not treated as an error.
|
||||||
// Instead, they are replaced by the Unicode replacement
|
// Instead, they are replaced by the Unicode replacement
|
||||||
// character U+FFFD.
|
// character U+FFFD.
|
||||||
//
|
|
||||||
func Unmarshal(data []byte, v interface{}) error {
|
func Unmarshal(data []byte, v interface{}) error {
|
||||||
return unmarshal(data, v)
|
return unmarshal(data, v)
|
||||||
}
|
}
|
||||||
|
@ -299,7 +297,6 @@ func UnmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc)
|
||||||
// Number, for JSON numbers
|
// Number, for JSON numbers
|
||||||
// string, for JSON string literals
|
// string, for JSON string literals
|
||||||
// nil, for JSON null
|
// nil, for JSON null
|
||||||
//
|
|
||||||
type Token = json.Token
|
type Token = json.Token
|
||||||
|
|
||||||
// A Number represents a JSON number literal.
|
// A Number represents a JSON number literal.
|
||||||
|
|
|
@ -60,7 +60,7 @@
|
||||||
//
|
//
|
||||||
// The d variable is implicitly R_DST - R_DBASE, and len(dst)-d is R_DEND - R_DST.
|
// The d variable is implicitly R_DST - R_DBASE, and len(dst)-d is R_DEND - R_DST.
|
||||||
// The s variable is implicitly R_SRC - R_SBASE, and len(src)-s is R_SEND - R_SRC.
|
// The s variable is implicitly R_SRC - R_SBASE, and len(src)-s is R_SEND - R_SRC.
|
||||||
TEXT ·s2Decode(SB), NOSPLIT, $56-64
|
TEXT ·s2Decode(SB), NOSPLIT, $56-56
|
||||||
// Initialize R_SRC, R_DST and R_DBASE-R_SEND.
|
// Initialize R_SRC, R_DST and R_DBASE-R_SEND.
|
||||||
MOVD dst_base+0(FP), R_DBASE
|
MOVD dst_base+0(FP), R_DBASE
|
||||||
MOVD dst_len+8(FP), R_DLEN
|
MOVD dst_len+8(FP), R_DLEN
|
||||||
|
|
|
@ -17,6 +17,8 @@ const (
|
||||||
S2IndexHeader = "s2idx\x00"
|
S2IndexHeader = "s2idx\x00"
|
||||||
S2IndexTrailer = "\x00xdi2s"
|
S2IndexTrailer = "\x00xdi2s"
|
||||||
maxIndexEntries = 1 << 16
|
maxIndexEntries = 1 << 16
|
||||||
|
// If distance is less than this, we do not add the entry.
|
||||||
|
minIndexDist = 1 << 20
|
||||||
)
|
)
|
||||||
|
|
||||||
// Index represents an S2/Snappy index.
|
// Index represents an S2/Snappy index.
|
||||||
|
@ -72,6 +74,10 @@ func (i *Index) add(compressedOffset, uncompressedOffset int64) error {
|
||||||
if latest.compressedOffset > compressedOffset {
|
if latest.compressedOffset > compressedOffset {
|
||||||
return fmt.Errorf("internal error: Earlier compressed received (%d > %d)", latest.uncompressedOffset, uncompressedOffset)
|
return fmt.Errorf("internal error: Earlier compressed received (%d > %d)", latest.uncompressedOffset, uncompressedOffset)
|
||||||
}
|
}
|
||||||
|
if latest.uncompressedOffset+minIndexDist > uncompressedOffset {
|
||||||
|
// Only add entry if distance is large enough.
|
||||||
|
return nil
|
||||||
|
}
|
||||||
}
|
}
|
||||||
i.info = append(i.info, struct {
|
i.info = append(i.info, struct {
|
||||||
compressedOffset int64
|
compressedOffset int64
|
||||||
|
@ -122,7 +128,7 @@ func (i *Index) Find(offset int64) (compressedOff, uncompressedOff int64, err er
|
||||||
|
|
||||||
// reduce to stay below maxIndexEntries
|
// reduce to stay below maxIndexEntries
|
||||||
func (i *Index) reduce() {
|
func (i *Index) reduce() {
|
||||||
if len(i.info) < maxIndexEntries && i.estBlockUncomp >= 1<<20 {
|
if len(i.info) < maxIndexEntries && i.estBlockUncomp >= minIndexDist {
|
||||||
return
|
return
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -132,7 +138,7 @@ func (i *Index) reduce() {
|
||||||
j := 0
|
j := 0
|
||||||
|
|
||||||
// Each block should be at least 1MB, but don't reduce below 1000 entries.
|
// Each block should be at least 1MB, but don't reduce below 1000 entries.
|
||||||
for i.estBlockUncomp*(int64(removeN)+1) < 1<<20 && len(i.info)/(removeN+1) > 1000 {
|
for i.estBlockUncomp*(int64(removeN)+1) < minIndexDist && len(i.info)/(removeN+1) > 1000 {
|
||||||
removeN++
|
removeN++
|
||||||
}
|
}
|
||||||
for idx := 0; idx < len(src); idx++ {
|
for idx := 0; idx < len(src); idx++ {
|
||||||
|
|
|
@ -109,7 +109,11 @@ const (
|
||||||
chunkTypeStreamIdentifier = 0xff
|
chunkTypeStreamIdentifier = 0xff
|
||||||
)
|
)
|
||||||
|
|
||||||
var crcTable = crc32.MakeTable(crc32.Castagnoli)
|
var (
|
||||||
|
crcTable = crc32.MakeTable(crc32.Castagnoli)
|
||||||
|
magicChunkSnappyBytes = []byte(magicChunkSnappy) // Can be passed to functions where it escapes.
|
||||||
|
magicChunkBytes = []byte(magicChunk) // Can be passed to functions where it escapes.
|
||||||
|
)
|
||||||
|
|
||||||
// crc implements the checksum specified in section 3 of
|
// crc implements the checksum specified in section 3 of
|
||||||
// https://github.com/google/snappy/blob/master/framing_format.txt
|
// https://github.com/google/snappy/blob/master/framing_format.txt
|
||||||
|
|
|
@ -239,6 +239,9 @@ func (w *Writer) ReadFrom(r io.Reader) (n int64, err error) {
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
if n2 == 0 {
|
if n2 == 0 {
|
||||||
|
if cap(inbuf) >= w.obufLen {
|
||||||
|
w.buffers.Put(inbuf)
|
||||||
|
}
|
||||||
break
|
break
|
||||||
}
|
}
|
||||||
n += int64(n2)
|
n += int64(n2)
|
||||||
|
@ -314,9 +317,9 @@ func (w *Writer) AddSkippableBlock(id uint8, data []byte) (err error) {
|
||||||
hWriter := make(chan result)
|
hWriter := make(chan result)
|
||||||
w.output <- hWriter
|
w.output <- hWriter
|
||||||
if w.snappy {
|
if w.snappy {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes}
|
||||||
} else {
|
} else {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -370,9 +373,9 @@ func (w *Writer) EncodeBuffer(buf []byte) (err error) {
|
||||||
hWriter := make(chan result)
|
hWriter := make(chan result)
|
||||||
w.output <- hWriter
|
w.output <- hWriter
|
||||||
if w.snappy {
|
if w.snappy {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes}
|
||||||
} else {
|
} else {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -478,9 +481,9 @@ func (w *Writer) write(p []byte) (nRet int, errRet error) {
|
||||||
hWriter := make(chan result)
|
hWriter := make(chan result)
|
||||||
w.output <- hWriter
|
w.output <- hWriter
|
||||||
if w.snappy {
|
if w.snappy {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes}
|
||||||
} else {
|
} else {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -560,6 +563,9 @@ func (w *Writer) writeFull(inbuf []byte) (errRet error) {
|
||||||
|
|
||||||
if w.concurrency == 1 {
|
if w.concurrency == 1 {
|
||||||
_, err := w.writeSync(inbuf[obufHeaderLen:])
|
_, err := w.writeSync(inbuf[obufHeaderLen:])
|
||||||
|
if cap(inbuf) >= w.obufLen {
|
||||||
|
w.buffers.Put(inbuf)
|
||||||
|
}
|
||||||
return err
|
return err
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -569,9 +575,9 @@ func (w *Writer) writeFull(inbuf []byte) (errRet error) {
|
||||||
hWriter := make(chan result)
|
hWriter := make(chan result)
|
||||||
w.output <- hWriter
|
w.output <- hWriter
|
||||||
if w.snappy {
|
if w.snappy {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes}
|
||||||
} else {
|
} else {
|
||||||
hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)}
|
hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes}
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|
||||||
|
@ -637,9 +643,9 @@ func (w *Writer) writeSync(p []byte) (nRet int, errRet error) {
|
||||||
var n int
|
var n int
|
||||||
var err error
|
var err error
|
||||||
if w.snappy {
|
if w.snappy {
|
||||||
n, err = w.writer.Write([]byte(magicChunkSnappy))
|
n, err = w.writer.Write(magicChunkSnappyBytes)
|
||||||
} else {
|
} else {
|
||||||
n, err = w.writer.Write([]byte(magicChunk))
|
n, err = w.writer.Write(magicChunkBytes)
|
||||||
}
|
}
|
||||||
if err != nil {
|
if err != nil {
|
||||||
return 0, w.err(err)
|
return 0, w.err(err)
|
||||||
|
|
|
@ -310,6 +310,7 @@ Exit Code 1
|
||||||
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
|
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
|
||||||
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
|
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
|
||||||
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
|
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
|
||||||
|
| AVXVNNIINT16 | AVX-VNNI-INT16 instructions |
|
||||||
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
|
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
|
||||||
| BMI1 | Bit Manipulation Instruction Set 1 |
|
| BMI1 | Bit Manipulation Instruction Set 1 |
|
||||||
| BMI2 | Bit Manipulation Instruction Set 2 |
|
| BMI2 | Bit Manipulation Instruction Set 2 |
|
||||||
|
|
|
@ -104,6 +104,7 @@ const (
|
||||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
||||||
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
||||||
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
||||||
|
AVXVNNIINT16 // AVX-VNNI-INT16 instructions
|
||||||
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
||||||
BMI1 // Bit Manipulation Instruction Set 1
|
BMI1 // Bit Manipulation Instruction Set 1
|
||||||
BMI2 // Bit Manipulation Instruction Set 2
|
BMI2 // Bit Manipulation Instruction Set 2
|
||||||
|
@ -1242,6 +1243,7 @@ func support() flagSet {
|
||||||
// CPUID.(EAX=7, ECX=1).EDX
|
// CPUID.(EAX=7, ECX=1).EDX
|
||||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||||
|
fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
|
||||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||||
fs.setIf(edx1&(1<<21) != 0, APX_F)
|
fs.setIf(edx1&(1<<21) != 0, APX_F)
|
||||||
|
|
|
@ -44,194 +44,195 @@ func _() {
|
||||||
_ = x[AVXSLOW-34]
|
_ = x[AVXSLOW-34]
|
||||||
_ = x[AVXVNNI-35]
|
_ = x[AVXVNNI-35]
|
||||||
_ = x[AVXVNNIINT8-36]
|
_ = x[AVXVNNIINT8-36]
|
||||||
_ = x[BHI_CTRL-37]
|
_ = x[AVXVNNIINT16-37]
|
||||||
_ = x[BMI1-38]
|
_ = x[BHI_CTRL-38]
|
||||||
_ = x[BMI2-39]
|
_ = x[BMI1-39]
|
||||||
_ = x[CETIBT-40]
|
_ = x[BMI2-40]
|
||||||
_ = x[CETSS-41]
|
_ = x[CETIBT-41]
|
||||||
_ = x[CLDEMOTE-42]
|
_ = x[CETSS-42]
|
||||||
_ = x[CLMUL-43]
|
_ = x[CLDEMOTE-43]
|
||||||
_ = x[CLZERO-44]
|
_ = x[CLMUL-44]
|
||||||
_ = x[CMOV-45]
|
_ = x[CLZERO-45]
|
||||||
_ = x[CMPCCXADD-46]
|
_ = x[CMOV-46]
|
||||||
_ = x[CMPSB_SCADBS_SHORT-47]
|
_ = x[CMPCCXADD-47]
|
||||||
_ = x[CMPXCHG8-48]
|
_ = x[CMPSB_SCADBS_SHORT-48]
|
||||||
_ = x[CPBOOST-49]
|
_ = x[CMPXCHG8-49]
|
||||||
_ = x[CPPC-50]
|
_ = x[CPBOOST-50]
|
||||||
_ = x[CX16-51]
|
_ = x[CPPC-51]
|
||||||
_ = x[EFER_LMSLE_UNS-52]
|
_ = x[CX16-52]
|
||||||
_ = x[ENQCMD-53]
|
_ = x[EFER_LMSLE_UNS-53]
|
||||||
_ = x[ERMS-54]
|
_ = x[ENQCMD-54]
|
||||||
_ = x[F16C-55]
|
_ = x[ERMS-55]
|
||||||
_ = x[FLUSH_L1D-56]
|
_ = x[F16C-56]
|
||||||
_ = x[FMA3-57]
|
_ = x[FLUSH_L1D-57]
|
||||||
_ = x[FMA4-58]
|
_ = x[FMA3-58]
|
||||||
_ = x[FP128-59]
|
_ = x[FMA4-59]
|
||||||
_ = x[FP256-60]
|
_ = x[FP128-60]
|
||||||
_ = x[FSRM-61]
|
_ = x[FP256-61]
|
||||||
_ = x[FXSR-62]
|
_ = x[FSRM-62]
|
||||||
_ = x[FXSROPT-63]
|
_ = x[FXSR-63]
|
||||||
_ = x[GFNI-64]
|
_ = x[FXSROPT-64]
|
||||||
_ = x[HLE-65]
|
_ = x[GFNI-65]
|
||||||
_ = x[HRESET-66]
|
_ = x[HLE-66]
|
||||||
_ = x[HTT-67]
|
_ = x[HRESET-67]
|
||||||
_ = x[HWA-68]
|
_ = x[HTT-68]
|
||||||
_ = x[HYBRID_CPU-69]
|
_ = x[HWA-69]
|
||||||
_ = x[HYPERVISOR-70]
|
_ = x[HYBRID_CPU-70]
|
||||||
_ = x[IA32_ARCH_CAP-71]
|
_ = x[HYPERVISOR-71]
|
||||||
_ = x[IA32_CORE_CAP-72]
|
_ = x[IA32_ARCH_CAP-72]
|
||||||
_ = x[IBPB-73]
|
_ = x[IA32_CORE_CAP-73]
|
||||||
_ = x[IBPB_BRTYPE-74]
|
_ = x[IBPB-74]
|
||||||
_ = x[IBRS-75]
|
_ = x[IBPB_BRTYPE-75]
|
||||||
_ = x[IBRS_PREFERRED-76]
|
_ = x[IBRS-76]
|
||||||
_ = x[IBRS_PROVIDES_SMP-77]
|
_ = x[IBRS_PREFERRED-77]
|
||||||
_ = x[IBS-78]
|
_ = x[IBRS_PROVIDES_SMP-78]
|
||||||
_ = x[IBSBRNTRGT-79]
|
_ = x[IBS-79]
|
||||||
_ = x[IBSFETCHSAM-80]
|
_ = x[IBSBRNTRGT-80]
|
||||||
_ = x[IBSFFV-81]
|
_ = x[IBSFETCHSAM-81]
|
||||||
_ = x[IBSOPCNT-82]
|
_ = x[IBSFFV-82]
|
||||||
_ = x[IBSOPCNTEXT-83]
|
_ = x[IBSOPCNT-83]
|
||||||
_ = x[IBSOPSAM-84]
|
_ = x[IBSOPCNTEXT-84]
|
||||||
_ = x[IBSRDWROPCNT-85]
|
_ = x[IBSOPSAM-85]
|
||||||
_ = x[IBSRIPINVALIDCHK-86]
|
_ = x[IBSRDWROPCNT-86]
|
||||||
_ = x[IBS_FETCH_CTLX-87]
|
_ = x[IBSRIPINVALIDCHK-87]
|
||||||
_ = x[IBS_OPDATA4-88]
|
_ = x[IBS_FETCH_CTLX-88]
|
||||||
_ = x[IBS_OPFUSE-89]
|
_ = x[IBS_OPDATA4-89]
|
||||||
_ = x[IBS_PREVENTHOST-90]
|
_ = x[IBS_OPFUSE-90]
|
||||||
_ = x[IBS_ZEN4-91]
|
_ = x[IBS_PREVENTHOST-91]
|
||||||
_ = x[IDPRED_CTRL-92]
|
_ = x[IBS_ZEN4-92]
|
||||||
_ = x[INT_WBINVD-93]
|
_ = x[IDPRED_CTRL-93]
|
||||||
_ = x[INVLPGB-94]
|
_ = x[INT_WBINVD-94]
|
||||||
_ = x[KEYLOCKER-95]
|
_ = x[INVLPGB-95]
|
||||||
_ = x[KEYLOCKERW-96]
|
_ = x[KEYLOCKER-96]
|
||||||
_ = x[LAHF-97]
|
_ = x[KEYLOCKERW-97]
|
||||||
_ = x[LAM-98]
|
_ = x[LAHF-98]
|
||||||
_ = x[LBRVIRT-99]
|
_ = x[LAM-99]
|
||||||
_ = x[LZCNT-100]
|
_ = x[LBRVIRT-100]
|
||||||
_ = x[MCAOVERFLOW-101]
|
_ = x[LZCNT-101]
|
||||||
_ = x[MCDT_NO-102]
|
_ = x[MCAOVERFLOW-102]
|
||||||
_ = x[MCOMMIT-103]
|
_ = x[MCDT_NO-103]
|
||||||
_ = x[MD_CLEAR-104]
|
_ = x[MCOMMIT-104]
|
||||||
_ = x[MMX-105]
|
_ = x[MD_CLEAR-105]
|
||||||
_ = x[MMXEXT-106]
|
_ = x[MMX-106]
|
||||||
_ = x[MOVBE-107]
|
_ = x[MMXEXT-107]
|
||||||
_ = x[MOVDIR64B-108]
|
_ = x[MOVBE-108]
|
||||||
_ = x[MOVDIRI-109]
|
_ = x[MOVDIR64B-109]
|
||||||
_ = x[MOVSB_ZL-110]
|
_ = x[MOVDIRI-110]
|
||||||
_ = x[MOVU-111]
|
_ = x[MOVSB_ZL-111]
|
||||||
_ = x[MPX-112]
|
_ = x[MOVU-112]
|
||||||
_ = x[MSRIRC-113]
|
_ = x[MPX-113]
|
||||||
_ = x[MSRLIST-114]
|
_ = x[MSRIRC-114]
|
||||||
_ = x[MSR_PAGEFLUSH-115]
|
_ = x[MSRLIST-115]
|
||||||
_ = x[NRIPS-116]
|
_ = x[MSR_PAGEFLUSH-116]
|
||||||
_ = x[NX-117]
|
_ = x[NRIPS-117]
|
||||||
_ = x[OSXSAVE-118]
|
_ = x[NX-118]
|
||||||
_ = x[PCONFIG-119]
|
_ = x[OSXSAVE-119]
|
||||||
_ = x[POPCNT-120]
|
_ = x[PCONFIG-120]
|
||||||
_ = x[PPIN-121]
|
_ = x[POPCNT-121]
|
||||||
_ = x[PREFETCHI-122]
|
_ = x[PPIN-122]
|
||||||
_ = x[PSFD-123]
|
_ = x[PREFETCHI-123]
|
||||||
_ = x[RDPRU-124]
|
_ = x[PSFD-124]
|
||||||
_ = x[RDRAND-125]
|
_ = x[RDPRU-125]
|
||||||
_ = x[RDSEED-126]
|
_ = x[RDRAND-126]
|
||||||
_ = x[RDTSCP-127]
|
_ = x[RDSEED-127]
|
||||||
_ = x[RRSBA_CTRL-128]
|
_ = x[RDTSCP-128]
|
||||||
_ = x[RTM-129]
|
_ = x[RRSBA_CTRL-129]
|
||||||
_ = x[RTM_ALWAYS_ABORT-130]
|
_ = x[RTM-130]
|
||||||
_ = x[SBPB-131]
|
_ = x[RTM_ALWAYS_ABORT-131]
|
||||||
_ = x[SERIALIZE-132]
|
_ = x[SBPB-132]
|
||||||
_ = x[SEV-133]
|
_ = x[SERIALIZE-133]
|
||||||
_ = x[SEV_64BIT-134]
|
_ = x[SEV-134]
|
||||||
_ = x[SEV_ALTERNATIVE-135]
|
_ = x[SEV_64BIT-135]
|
||||||
_ = x[SEV_DEBUGSWAP-136]
|
_ = x[SEV_ALTERNATIVE-136]
|
||||||
_ = x[SEV_ES-137]
|
_ = x[SEV_DEBUGSWAP-137]
|
||||||
_ = x[SEV_RESTRICTED-138]
|
_ = x[SEV_ES-138]
|
||||||
_ = x[SEV_SNP-139]
|
_ = x[SEV_RESTRICTED-139]
|
||||||
_ = x[SGX-140]
|
_ = x[SEV_SNP-140]
|
||||||
_ = x[SGXLC-141]
|
_ = x[SGX-141]
|
||||||
_ = x[SHA-142]
|
_ = x[SGXLC-142]
|
||||||
_ = x[SME-143]
|
_ = x[SHA-143]
|
||||||
_ = x[SME_COHERENT-144]
|
_ = x[SME-144]
|
||||||
_ = x[SPEC_CTRL_SSBD-145]
|
_ = x[SME_COHERENT-145]
|
||||||
_ = x[SRBDS_CTRL-146]
|
_ = x[SPEC_CTRL_SSBD-146]
|
||||||
_ = x[SRSO_MSR_FIX-147]
|
_ = x[SRBDS_CTRL-147]
|
||||||
_ = x[SRSO_NO-148]
|
_ = x[SRSO_MSR_FIX-148]
|
||||||
_ = x[SRSO_USER_KERNEL_NO-149]
|
_ = x[SRSO_NO-149]
|
||||||
_ = x[SSE-150]
|
_ = x[SRSO_USER_KERNEL_NO-150]
|
||||||
_ = x[SSE2-151]
|
_ = x[SSE-151]
|
||||||
_ = x[SSE3-152]
|
_ = x[SSE2-152]
|
||||||
_ = x[SSE4-153]
|
_ = x[SSE3-153]
|
||||||
_ = x[SSE42-154]
|
_ = x[SSE4-154]
|
||||||
_ = x[SSE4A-155]
|
_ = x[SSE42-155]
|
||||||
_ = x[SSSE3-156]
|
_ = x[SSE4A-156]
|
||||||
_ = x[STIBP-157]
|
_ = x[SSSE3-157]
|
||||||
_ = x[STIBP_ALWAYSON-158]
|
_ = x[STIBP-158]
|
||||||
_ = x[STOSB_SHORT-159]
|
_ = x[STIBP_ALWAYSON-159]
|
||||||
_ = x[SUCCOR-160]
|
_ = x[STOSB_SHORT-160]
|
||||||
_ = x[SVM-161]
|
_ = x[SUCCOR-161]
|
||||||
_ = x[SVMDA-162]
|
_ = x[SVM-162]
|
||||||
_ = x[SVMFBASID-163]
|
_ = x[SVMDA-163]
|
||||||
_ = x[SVML-164]
|
_ = x[SVMFBASID-164]
|
||||||
_ = x[SVMNP-165]
|
_ = x[SVML-165]
|
||||||
_ = x[SVMPF-166]
|
_ = x[SVMNP-166]
|
||||||
_ = x[SVMPFT-167]
|
_ = x[SVMPF-167]
|
||||||
_ = x[SYSCALL-168]
|
_ = x[SVMPFT-168]
|
||||||
_ = x[SYSEE-169]
|
_ = x[SYSCALL-169]
|
||||||
_ = x[TBM-170]
|
_ = x[SYSEE-170]
|
||||||
_ = x[TDX_GUEST-171]
|
_ = x[TBM-171]
|
||||||
_ = x[TLB_FLUSH_NESTED-172]
|
_ = x[TDX_GUEST-172]
|
||||||
_ = x[TME-173]
|
_ = x[TLB_FLUSH_NESTED-173]
|
||||||
_ = x[TOPEXT-174]
|
_ = x[TME-174]
|
||||||
_ = x[TSCRATEMSR-175]
|
_ = x[TOPEXT-175]
|
||||||
_ = x[TSXLDTRK-176]
|
_ = x[TSCRATEMSR-176]
|
||||||
_ = x[VAES-177]
|
_ = x[TSXLDTRK-177]
|
||||||
_ = x[VMCBCLEAN-178]
|
_ = x[VAES-178]
|
||||||
_ = x[VMPL-179]
|
_ = x[VMCBCLEAN-179]
|
||||||
_ = x[VMSA_REGPROT-180]
|
_ = x[VMPL-180]
|
||||||
_ = x[VMX-181]
|
_ = x[VMSA_REGPROT-181]
|
||||||
_ = x[VPCLMULQDQ-182]
|
_ = x[VMX-182]
|
||||||
_ = x[VTE-183]
|
_ = x[VPCLMULQDQ-183]
|
||||||
_ = x[WAITPKG-184]
|
_ = x[VTE-184]
|
||||||
_ = x[WBNOINVD-185]
|
_ = x[WAITPKG-185]
|
||||||
_ = x[WRMSRNS-186]
|
_ = x[WBNOINVD-186]
|
||||||
_ = x[X87-187]
|
_ = x[WRMSRNS-187]
|
||||||
_ = x[XGETBV1-188]
|
_ = x[X87-188]
|
||||||
_ = x[XOP-189]
|
_ = x[XGETBV1-189]
|
||||||
_ = x[XSAVE-190]
|
_ = x[XOP-190]
|
||||||
_ = x[XSAVEC-191]
|
_ = x[XSAVE-191]
|
||||||
_ = x[XSAVEOPT-192]
|
_ = x[XSAVEC-192]
|
||||||
_ = x[XSAVES-193]
|
_ = x[XSAVEOPT-193]
|
||||||
_ = x[AESARM-194]
|
_ = x[XSAVES-194]
|
||||||
_ = x[ARMCPUID-195]
|
_ = x[AESARM-195]
|
||||||
_ = x[ASIMD-196]
|
_ = x[ARMCPUID-196]
|
||||||
_ = x[ASIMDDP-197]
|
_ = x[ASIMD-197]
|
||||||
_ = x[ASIMDHP-198]
|
_ = x[ASIMDDP-198]
|
||||||
_ = x[ASIMDRDM-199]
|
_ = x[ASIMDHP-199]
|
||||||
_ = x[ATOMICS-200]
|
_ = x[ASIMDRDM-200]
|
||||||
_ = x[CRC32-201]
|
_ = x[ATOMICS-201]
|
||||||
_ = x[DCPOP-202]
|
_ = x[CRC32-202]
|
||||||
_ = x[EVTSTRM-203]
|
_ = x[DCPOP-203]
|
||||||
_ = x[FCMA-204]
|
_ = x[EVTSTRM-204]
|
||||||
_ = x[FP-205]
|
_ = x[FCMA-205]
|
||||||
_ = x[FPHP-206]
|
_ = x[FP-206]
|
||||||
_ = x[GPA-207]
|
_ = x[FPHP-207]
|
||||||
_ = x[JSCVT-208]
|
_ = x[GPA-208]
|
||||||
_ = x[LRCPC-209]
|
_ = x[JSCVT-209]
|
||||||
_ = x[PMULL-210]
|
_ = x[LRCPC-210]
|
||||||
_ = x[SHA1-211]
|
_ = x[PMULL-211]
|
||||||
_ = x[SHA2-212]
|
_ = x[SHA1-212]
|
||||||
_ = x[SHA3-213]
|
_ = x[SHA2-213]
|
||||||
_ = x[SHA512-214]
|
_ = x[SHA3-214]
|
||||||
_ = x[SM3-215]
|
_ = x[SHA512-215]
|
||||||
_ = x[SM4-216]
|
_ = x[SM3-216]
|
||||||
_ = x[SVE-217]
|
_ = x[SM4-217]
|
||||||
_ = x[lastID-218]
|
_ = x[SVE-218]
|
||||||
|
_ = x[lastID-219]
|
||||||
_ = x[firstID-0]
|
_ = x[firstID-0]
|
||||||
}
|
}
|
||||||
|
|
||||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||||
|
|
||||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574}
|
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586}
|
||||||
|
|
||||||
func (i FeatureID) String() string {
|
func (i FeatureID) String() string {
|
||||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||||
|
|
|
@ -637,7 +637,9 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
|
||||||
// Sort all completed parts.
|
// Sort all completed parts.
|
||||||
sort.Sort(completedParts(complMultipartUpload.Parts))
|
sort.Sort(completedParts(complMultipartUpload.Parts))
|
||||||
|
|
||||||
opts = PutObjectOptions{}
|
opts = PutObjectOptions{
|
||||||
|
ServerSideEncryption: opts.ServerSideEncryption,
|
||||||
|
}
|
||||||
if len(crcBytes) > 0 {
|
if len(crcBytes) > 0 {
|
||||||
// Add hash of hashes.
|
// Add hash of hashes.
|
||||||
crc.Reset()
|
crc.Reset()
|
||||||
|
|
|
@ -464,7 +464,9 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
|
||||||
// Sort all completed parts.
|
// Sort all completed parts.
|
||||||
sort.Sort(completedParts(complMultipartUpload.Parts))
|
sort.Sort(completedParts(complMultipartUpload.Parts))
|
||||||
|
|
||||||
opts = PutObjectOptions{}
|
opts = PutObjectOptions{
|
||||||
|
ServerSideEncryption: opts.ServerSideEncryption,
|
||||||
|
}
|
||||||
if len(crcBytes) > 0 {
|
if len(crcBytes) > 0 {
|
||||||
// Add hash of hashes.
|
// Add hash of hashes.
|
||||||
crc.Reset()
|
crc.Reset()
|
||||||
|
|
|
@ -129,7 +129,7 @@ type Options struct {
|
||||||
// Global constants.
|
// Global constants.
|
||||||
const (
|
const (
|
||||||
libraryName = "minio-go"
|
libraryName = "minio-go"
|
||||||
libraryVersion = "v7.0.72"
|
libraryVersion = "v7.0.73"
|
||||||
)
|
)
|
||||||
|
|
||||||
// User Agent should always following the below style.
|
// User Agent should always following the below style.
|
||||||
|
|
|
@ -26,7 +26,7 @@ import (
|
||||||
"strings"
|
"strings"
|
||||||
"time"
|
"time"
|
||||||
|
|
||||||
ini "gopkg.in/ini.v1"
|
"github.com/go-ini/ini"
|
||||||
)
|
)
|
||||||
|
|
||||||
// A externalProcessCredentials stores the output of a credential_process
|
// A externalProcessCredentials stores the output of a credential_process
|
||||||
|
|
|
@ -406,6 +406,9 @@ func (c *Config) EditRule(opts Options) error {
|
||||||
return fmt.Errorf("priority must be unique. Replication configuration already has a rule with this priority")
|
return fmt.Errorf("priority must be unique. Replication configuration already has a rule with this priority")
|
||||||
}
|
}
|
||||||
if rule.Destination.Bucket != newRule.Destination.Bucket && rule.ID == newRule.ID {
|
if rule.Destination.Bucket != newRule.Destination.Bucket && rule.ID == newRule.ID {
|
||||||
|
if c.Role == newRule.Destination.Bucket {
|
||||||
|
continue
|
||||||
|
}
|
||||||
return fmt.Errorf("invalid destination bucket for this rule")
|
return fmt.Errorf("invalid destination bucket for this rule")
|
||||||
}
|
}
|
||||||
}
|
}
|
||||||
|
|
|
@ -44,6 +44,10 @@ var awsS3EndpointMap = map[string]awsS3Endpoint{
|
||||||
"s3.ca-central-1.amazonaws.com",
|
"s3.ca-central-1.amazonaws.com",
|
||||||
"s3.dualstack.ca-central-1.amazonaws.com",
|
"s3.dualstack.ca-central-1.amazonaws.com",
|
||||||
},
|
},
|
||||||
|
"ca-west-1": {
|
||||||
|
"s3.ca-west-1.amazonaws.com",
|
||||||
|
"s3.dualstack.ca-west-1.amazonaws.com",
|
||||||
|
},
|
||||||
"eu-west-1": {
|
"eu-west-1": {
|
||||||
"s3.eu-west-1.amazonaws.com",
|
"s3.eu-west-1.amazonaws.com",
|
||||||
"s3.dualstack.eu-west-1.amazonaws.com",
|
"s3.dualstack.eu-west-1.amazonaws.com",
|
||||||
|
|
|
@ -238,6 +238,9 @@ github.com/go-errors/errors
|
||||||
# github.com/go-fed/httpsig v1.1.0
|
# github.com/go-fed/httpsig v1.1.0
|
||||||
## explicit; go 1.13
|
## explicit; go 1.13
|
||||||
github.com/go-fed/httpsig
|
github.com/go-fed/httpsig
|
||||||
|
# github.com/go-ini/ini v1.67.0
|
||||||
|
## explicit
|
||||||
|
github.com/go-ini/ini
|
||||||
# github.com/go-jose/go-jose/v4 v4.0.1
|
# github.com/go-jose/go-jose/v4 v4.0.1
|
||||||
## explicit; go 1.21
|
## explicit; go 1.21
|
||||||
github.com/go-jose/go-jose/v4
|
github.com/go-jose/go-jose/v4
|
||||||
|
@ -322,8 +325,8 @@ github.com/go-swagger/go-swagger/generator
|
||||||
# github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850
|
# github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850
|
||||||
## explicit
|
## explicit
|
||||||
github.com/go-xmlfmt/xmlfmt
|
github.com/go-xmlfmt/xmlfmt
|
||||||
# github.com/goccy/go-json v0.10.2
|
# github.com/goccy/go-json v0.10.3
|
||||||
## explicit; go 1.12
|
## explicit; go 1.19
|
||||||
github.com/goccy/go-json
|
github.com/goccy/go-json
|
||||||
github.com/goccy/go-json/internal/decoder
|
github.com/goccy/go-json/internal/decoder
|
||||||
github.com/goccy/go-json/internal/encoder
|
github.com/goccy/go-json/internal/encoder
|
||||||
|
@ -450,11 +453,11 @@ github.com/josharian/intern
|
||||||
# github.com/json-iterator/go v1.1.12
|
# github.com/json-iterator/go v1.1.12
|
||||||
## explicit; go 1.12
|
## explicit; go 1.12
|
||||||
github.com/json-iterator/go
|
github.com/json-iterator/go
|
||||||
# github.com/klauspost/compress v1.17.8
|
# github.com/klauspost/compress v1.17.9
|
||||||
## explicit; go 1.20
|
## explicit; go 1.20
|
||||||
github.com/klauspost/compress/internal/race
|
github.com/klauspost/compress/internal/race
|
||||||
github.com/klauspost/compress/s2
|
github.com/klauspost/compress/s2
|
||||||
# github.com/klauspost/cpuid/v2 v2.2.7
|
# github.com/klauspost/cpuid/v2 v2.2.8
|
||||||
## explicit; go 1.15
|
## explicit; go 1.15
|
||||||
github.com/klauspost/cpuid/v2
|
github.com/klauspost/cpuid/v2
|
||||||
# github.com/kr/pretty v0.3.1
|
# github.com/kr/pretty v0.3.1
|
||||||
|
@ -488,7 +491,7 @@ github.com/miekg/dns
|
||||||
# github.com/minio/md5-simd v1.1.2
|
# github.com/minio/md5-simd v1.1.2
|
||||||
## explicit; go 1.14
|
## explicit; go 1.14
|
||||||
github.com/minio/md5-simd
|
github.com/minio/md5-simd
|
||||||
# github.com/minio/minio-go/v7 v7.0.72
|
# github.com/minio/minio-go/v7 v7.0.73
|
||||||
## explicit; go 1.21
|
## explicit; go 1.21
|
||||||
github.com/minio/minio-go/v7
|
github.com/minio/minio-go/v7
|
||||||
github.com/minio/minio-go/v7/pkg/credentials
|
github.com/minio/minio-go/v7/pkg/credentials
|
||||||
|
|
Loading…
Reference in New Issue